Recombinant Human C4B Protein, GST-Tagged
Cat.No. : | C4B-0051H |
Product Overview : | Human C4B partial ORF (NP_000583, 1347 a.a. - 1446 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes the basic form of complement factor 4, part of the classical activation pathway. The protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains prior to secretion. The trimer provides a surface for interaction between the antigen-antibody complex and other complement components. The alpha chain may be cleaved to release C4 anaphylatoxin, a mediator of local inflammation. Deficiency of this protein is associated with systemic lupus erythematosus. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. Varying haplotypes of this gene cluster exist, such that individuals may have 1, 2, or 3 copies of this gene. In addition, this gene exists as a long form and a short form due to the presence or absence of a 6.4 kb endogenous HERV-K retrovirus in intron 9. This record represents the second, more telomeric copy of this gene found in some haplotypes. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | NNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDYEDYEYDELPAKDDPDAPLQPVTPLQLFEG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C4B complement component 4B, telomeric [ Homo sapiens ] |
Official Symbol | C4B |
Synonyms | C4B; complement component 4B, telomeric; C4A; C4F; CO4; C4B1; C4B2; C4B3; C4B5; C4A91; C4B12; |
Gene ID | 721 |
mRNA Refseq | NM_001002029 |
Protein Refseq | NP_001002029 |
MIM | 120820 |
UniProt ID | P0C0L5 |
◆ Recombinant Proteins | ||
C4b-6785M | Recombinant Mouse C4b protein, His-tagged | +Inquiry |
C4B-08H | Recombinant Human C4B protein, His-tagged | +Inquiry |
C4b-4533M | Recombinant Mouse C4b protein | +Inquiry |
C4B-1147M | Recombinant Mouse C4B Protein, His (Fc)-Avi-tagged | +Inquiry |
C4B-2587M | Recombinant Mouse C4B Protein | +Inquiry |
◆ Native Proteins | ||
C4B-10H | Native Human C4B Protein | +Inquiry |
C4B-1846H | Native Human C4B Protein | +Inquiry |
C4B-99H | Native Human C4b Binding Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C4B Products
Required fields are marked with *
My Review for All C4B Products
Required fields are marked with *
0
Inquiry Basket