Recombinant Human C4B Protein, GST-Tagged

Cat.No. : C4B-0051H
Product Overview : Human C4B partial ORF (NP_000583, 1347 a.a. - 1446 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes the basic form of complement factor 4, part of the classical activation pathway. The protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains prior to secretion. The trimer provides a surface for interaction between the antigen-antibody complex and other complement components. The alpha chain may be cleaved to release C4 anaphylatoxin, a mediator of local inflammation. Deficiency of this protein is associated with systemic lupus erythematosus. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. Varying haplotypes of this gene cluster exist, such that individuals may have 1, 2, or 3 copies of this gene. In addition, this gene exists as a long form and a short form due to the presence or absence of a 6.4 kb endogenous HERV-K retrovirus in intron 9. This record represents the second, more telomeric copy of this gene found in some haplotypes.
Molecular Mass : 36.74 kDa
AA Sequence : NNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDYEDYEYDELPAKDDPDAPLQPVTPLQLFEG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C4B complement component 4B, telomeric [ Homo sapiens ]
Official Symbol C4B
Synonyms C4B; complement component 4B, telomeric; C4A; C4F; CO4; C4B1; C4B2; C4B3; C4B5; C4A91; C4B12;
Gene ID 721
mRNA Refseq NM_001002029
Protein Refseq NP_001002029
MIM 120820
UniProt ID P0C0L5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C4B Products

Required fields are marked with *

My Review for All C4B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon