Recombinant Human C5 Protein, GST-Tagged
Cat.No. : | C5-0077H |
Product Overview : | Human C5 partial ORF (NP_001726, 1550 a.a. - 1661 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a component of the complement system, a part of the innate immune system that plays an important role in inflammation, host homeostasis, and host defense against pathogens. The encoded preproprotein is proteolytically processed to generate multiple protein products, including the C5 alpha chain, C5 beta chain, C5a anaphylatoxin and C5b. The C5 protein is comprised of the C5 alpha and beta chains, which are linked by a disulfide bridge. Cleavage of the alpha chain by a convertase enzyme results in the formation of the C5a anaphylatoxin, which possesses potent spasmogenic and chemotactic activity, and the C5b macromolecular cleavage product, a subunit of the membrane attack complex (MAC). Mutations in this gene cause complement component 5 deficiency, a disease characterized by recurrent bacterial infections. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2015] |
Molecular Mass : | 38.06 kDa |
AA Sequence : | QTACKPEIAYAYKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIMGKEALQIKYNFSFRYIYPLDSLTWIEYWPRDTTCSSCQAFL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C5 complement component 5 [ Homo sapiens ] |
Official Symbol | C5 |
Synonyms | C5; complement component 5; complement C5; CPAMD4; anaphylatoxin C5a analog; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4; FLJ17816; FLJ17822; MGC142298; |
Gene ID | 727 |
mRNA Refseq | NM_001735 |
Protein Refseq | NP_001726 |
MIM | 120900 |
UniProt ID | P01031 |
◆ Recombinant Proteins | ||
C5-344H | Recombinant Human C5 Protein, His-tagged | +Inquiry |
C5-0293M | Recombinant Mouse C5 protein | +Inquiry |
C5-10539H | Recombinant Human C5, His-tagged | +Inquiry |
C5-2711M | Recombinant Mouse C5 Protein, His-tagged | +Inquiry |
C5-345H | Recombinant Human C5 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
C5-53H | Native Human Complement C5 | +Inquiry |
C5-10540H | Active Native Human C5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
C5-8020HCL | Recombinant Human C5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C5 Products
Required fields are marked with *
My Review for All C5 Products
Required fields are marked with *
0
Inquiry Basket