Recombinant Human C5 protein, His-SUMO-tagged
Cat.No. : | C5-2611H |
Product Overview : | Recombinant Human C5 protein(P01031)(678-751aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 678-751aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 24.3 kDa |
AA Sequence : | TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | C5 complement component 5 [ Homo sapiens ] |
Official Symbol | C5 |
Synonyms | C5; complement component 5; complement C5; CPAMD4; anaphylatoxin C5a analog; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4; FLJ17816; FLJ17822; MGC142298; |
Gene ID | 727 |
mRNA Refseq | NM_001735 |
Protein Refseq | NP_001726 |
MIM | 120900 |
UniProt ID | P01031 |
◆ Recombinant Proteins | ||
C5-565R | Recombinant Rat C5 Protein, His/GST-tagged | +Inquiry |
C5-851H | Recombinant Human C5 protein (W917S), His-tagged | +Inquiry |
C5-092H | Recombinant Human C5 protein, Fc-tagged | +Inquiry |
C5-562H | Recombinant Human C5 Protein, GST-tagged | +Inquiry |
C5-0277H | Recombinant Human C5 Protein (Thr678-Arg751), GST-tagged | +Inquiry |
◆ Native Proteins | ||
C5-10540H | Active Native Human C5 | +Inquiry |
C5-53H | Native Human Complement C5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
C5-8020HCL | Recombinant Human C5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C5 Products
Required fields are marked with *
My Review for All C5 Products
Required fields are marked with *
0
Inquiry Basket