Recombinant Human CA3 Protein, His-tagged
Cat.No. : | CA3-0188H |
Product Overview : | Recombinant Human CA3 protein(Ala2-Lys260), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Ala2-Lys260 |
Tag : | C-His |
Form : | Liquid in sterile PBS, pH7.4. |
Molecular Mass : | The protein has a calculated MW of 31 kDa. |
Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
Purity : | > 90 % as determined by SDS-PAGE. |
Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1.0 mg/ml. |
Reconstitution : | Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFKAHHHHHHHHHH |
Gene Name | CA3 carbonic anhydrase III, muscle specific [ Homo sapiens ] |
Official Symbol | CA3 |
Synonyms | CA3; carbonic anhydrase III, muscle specific; carbonic anhydrase 3; CAIII; Car3; CA-III; carbonate dehydratase III; FLJ36434; |
Gene ID | 761 |
mRNA Refseq | NM_005181 |
Protein Refseq | NP_005172 |
MIM | 114750 |
UniProt ID | P07451 |
◆ Recombinant Proteins | ||
CA3-1050H | Recombinant Human CA3 Protein (M1-K260), Tag Free | +Inquiry |
CA3-717R | Recombinant Rat CA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CA3-27267TH | Recombinant Human CA3, His-tagged | +Inquiry |
Car3-7834R | Recombinant Rat Car3 protein, His & T7-tagged | +Inquiry |
CA3-480H | Recombinant Human CA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CA3-7914HCL | Recombinant Human CA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CA3 Products
Required fields are marked with *
My Review for All CA3 Products
Required fields are marked with *