Recombinant Human CASTOR1 Protein, GST-tagged

• Cat.No.: CASTOR1-4758H
• Product Overview: Human LOC652968 full-length ORF ( CAK54431.1, 1 a.a. - 329 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CASTOR1 (Cytosolic Arginine Sensor For MTORC1 Subunit 1) is a Protein Coding gene. An important paralog of this gene is CASTOR2.
• Molecular Mass: 62.59 kDa
• AA Sequence: MELHILEHRVRVLSVARPGLWLYTHPLIKLLFLPRRSRCKFFSLTETPEDYTLMVDEEGFKELPPSEFLQVAEATWLVLNVSSHSGAAVQAAGVTKIARSVIAPLAEHHVSVLMLSTYQTDFILVREQDLSVVIHTLAQEFDIYREVGGEPVPVTRDDSSNGFPRTQHGPSPTVHPIQSPQNRFCVLTLDPETLPAIATTLIDVLFYSHSTPKEAASSSPEPSSITFFAFSLIEGYISIVMDAETQKKFPSDLLLTSSSGELWRMVRIGGQPLGFDECGIVAQIAGPLAAADISAYYISTFNFDHALVPEDGIGSVIEVLQRRQEGLAS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CASTOR1 cytosolic arginine sensor for mTORC1 subunit 1 [ Homo sapiens (human) ]
• Official Symbol: CASTOR1
• Synonyms: CASTOR1; cytosolic arginine sensor for mTORC1 subunit 1; GATSL3; cytosolic arginine sensor for mTORC1 subunit 1; GATS protein like 3; GATS-like protein 3; cellular arginine sensor for mTORC1 protein 1
• Gene ID: 652968
• mRNA Refseq: NM_001037666
• Protein Refseq: NP_001032755
• MIM: 617034
• UniProt ID: Q8WTX7