Recombinant Human CASTOR1 Protein, GST-tagged
Cat.No. : | CASTOR1-4758H |
Product Overview : | Human LOC652968 full-length ORF ( CAK54431.1, 1 a.a. - 329 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CASTOR1 (Cytosolic Arginine Sensor For MTORC1 Subunit 1) is a Protein Coding gene. An important paralog of this gene is CASTOR2. |
Molecular Mass : | 62.59 kDa |
AA Sequence : | MELHILEHRVRVLSVARPGLWLYTHPLIKLLFLPRRSRCKFFSLTETPEDYTLMVDEEGFKELPPSEFLQVAEATWLVLNVSSHSGAAVQAAGVTKIARSVIAPLAEHHVSVLMLSTYQTDFILVREQDLSVVIHTLAQEFDIYREVGGEPVPVTRDDSSNGFPRTQHGPSPTVHPIQSPQNRFCVLTLDPETLPAIATTLIDVLFYSHSTPKEAASSSPEPSSITFFAFSLIEGYISIVMDAETQKKFPSDLLLTSSSGELWRMVRIGGQPLGFDECGIVAQIAGPLAAADISAYYISTFNFDHALVPEDGIGSVIEVLQRRQEGLAS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CASTOR1 cytosolic arginine sensor for mTORC1 subunit 1 [ Homo sapiens (human) ] |
Official Symbol | CASTOR1 |
Synonyms | CASTOR1; cytosolic arginine sensor for mTORC1 subunit 1; GATSL3; cytosolic arginine sensor for mTORC1 subunit 1; GATS protein like 3; GATS-like protein 3; cellular arginine sensor for mTORC1 protein 1 |
Gene ID | 652968 |
mRNA Refseq | NM_001037666 |
Protein Refseq | NP_001032755 |
MIM | 617034 |
UniProt ID | Q8WTX7 |
◆ Recombinant Proteins | ||
Castor1-1970M | Recombinant Mouse Castor1 Protein, Myc/DDK-tagged | +Inquiry |
CASTOR1-1730HFL | Recombinant Full Length Human CASTOR1 Protein, C-Flag-tagged | +Inquiry |
CASTOR1-3060H | Recombinant Human CASTOR1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CASTOR1-5916HF | Recombinant Full Length Human CASTOR1 Protein, GST-tagged | +Inquiry |
CASTOR1-4758H | Recombinant Human CASTOR1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASTOR1 Products
Required fields are marked with *
My Review for All CASTOR1 Products
Required fields are marked with *