Recombinant Human CASTOR1 Protein, GST-tagged
| Cat.No. : | CASTOR1-4758H |
| Product Overview : | Human LOC652968 full-length ORF ( CAK54431.1, 1 a.a. - 329 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CASTOR1 (Cytosolic Arginine Sensor For MTORC1 Subunit 1) is a Protein Coding gene. An important paralog of this gene is CASTOR2. |
| Molecular Mass : | 62.59 kDa |
| AA Sequence : | MELHILEHRVRVLSVARPGLWLYTHPLIKLLFLPRRSRCKFFSLTETPEDYTLMVDEEGFKELPPSEFLQVAEATWLVLNVSSHSGAAVQAAGVTKIARSVIAPLAEHHVSVLMLSTYQTDFILVREQDLSVVIHTLAQEFDIYREVGGEPVPVTRDDSSNGFPRTQHGPSPTVHPIQSPQNRFCVLTLDPETLPAIATTLIDVLFYSHSTPKEAASSSPEPSSITFFAFSLIEGYISIVMDAETQKKFPSDLLLTSSSGELWRMVRIGGQPLGFDECGIVAQIAGPLAAADISAYYISTFNFDHALVPEDGIGSVIEVLQRRQEGLAS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CASTOR1 cytosolic arginine sensor for mTORC1 subunit 1 [ Homo sapiens (human) ] |
| Official Symbol | CASTOR1 |
| Synonyms | CASTOR1; cytosolic arginine sensor for mTORC1 subunit 1; GATSL3; cytosolic arginine sensor for mTORC1 subunit 1; GATS protein like 3; GATS-like protein 3; cellular arginine sensor for mTORC1 protein 1 |
| Gene ID | 652968 |
| mRNA Refseq | NM_001037666 |
| Protein Refseq | NP_001032755 |
| MIM | 617034 |
| UniProt ID | Q8WTX7 |
| ◆ Recombinant Proteins | ||
| CASTOR1-1730HFL | Recombinant Full Length Human CASTOR1 Protein, C-Flag-tagged | +Inquiry |
| CASTOR1-4758H | Recombinant Human CASTOR1 Protein, GST-tagged | +Inquiry |
| CASTOR1-510H | Recombinant Human CASTOR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CASTOR1-5916HF | Recombinant Full Length Human CASTOR1 Protein, GST-tagged | +Inquiry |
| CASTOR1-3060H | Recombinant Human CASTOR1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASTOR1 Products
Required fields are marked with *
My Review for All CASTOR1 Products
Required fields are marked with *



