Recombinant Full Length Human CASTOR1 Protein, C-Flag-tagged

Cat.No. : CASTOR1-1730HFL
Product Overview : Recombinant Full Length Human CASTOR1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Enables arginine binding activity and identical protein binding activity. Involved in cellular response to L-arginine and negative regulation of TORC1 signaling. Located in cytosol. Colocalizes with GATOR2 complex.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 36.1 kDa
AA Sequence : MELHILEHRVRVLSVARPGLWLYTHPLIKLLFLPRRSRCKFFSLTETPEDYTLMVDEEGFKELPPSEFLQ VAEATWLVLNVSSHSGAAVQAAGVTKIARSVIAPLAEHHVSVLMLSTYQTDFILVREQDLSVVIHTLAQE FDIYREVGGEPVPVTRDDSSNGFPRTQHGPSPTVHPIQSPQNRFCVLTLDPETLPAIATTLIDVLFYSHS TPKEAASSSPEPSSITFFAFSLIEGYISIVMDAETQKKFPSDLLLTSSSGELWRMVRIGGQPLGFDECGI
VAQIAGPLAAADISAYYISTFNFDHALVPEDGIGSVIEVLQRRQEGLASTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length : Full L.
Gene Name CASTOR1 cytosolic arginine sensor for mTORC1 subunit 1 [ Homo sapiens (human) ]
Official Symbol CASTOR1
Synonyms GATSL3
Gene ID 652968
mRNA Refseq NM_001037666.3
Protein Refseq NP_001032755.1
MIM 617034
UniProt ID Q8WTX7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CASTOR1 Products

Required fields are marked with *

My Review for All CASTOR1 Products

Required fields are marked with *

0
cart-icon