Recombinant Full Length Human CASTOR1 Protein, GST-tagged

Cat.No. : CASTOR1-5916HF
Product Overview : Human LOC652968 full-length ORF ( CAK54431.1, 1 a.a. - 329 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 329 amino acids
Description : CASTOR1 (Cytosolic Arginine Sensor For MTORC1 Subunit 1) is a Protein Coding gene. An important paralog of this gene is CASTOR2.
Molecular Mass : 62.59 kDa
AA Sequence : MELHILEHRVRVLSVARPGLWLYTHPLIKLLFLPRRSRCKFFSLTETPEDYTLMVDEEGFKELPPSEFLQVAEATWLVLNVSSHSGAAVQAAGVTKIARSVIAPLAEHHVSVLMLSTYQTDFILVREQDLSVVIHTLAQEFDIYREVGGEPVPVTRDDSSNGFPRTQHGPSPTVHPIQSPQNRFCVLTLDPETLPAIATTLIDVLFYSHSTPKEAASSSPEPSSITFFAFSLIEGYISIVMDAETQKKFPSDLLLTSSSGELWRMVRIGGQPLGFDECGIVAQIAGPLAAADISAYYISTFNFDHALVPEDGIGSVIEVLQRRQEGLAS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CASTOR1 cytosolic arginine sensor for mTORC1 subunit 1 [ Homo sapiens (human) ]
Official Symbol CASTOR1
Synonyms CASTOR1; cytosolic arginine sensor for mTORC1 subunit 1; GATSL3; cytosolic arginine sensor for mTORC1 subunit 1; GATS protein like 3; GATS-like protein 3; cellular arginine sensor for mTORC1 protein 1
Gene ID 652968
mRNA Refseq NM_001037666
Protein Refseq NP_001032755
MIM 617034
UniProt ID Q8WTX7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CASTOR1 Products

Required fields are marked with *

My Review for All CASTOR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon