| Species : | 
                                    Human | 
                                
                                
                                    | Source : | 
                                    E.coli | 
                                
                                
                                    | Tag : | 
                                    Non | 
                                
                                
                                    | Description : | 
                                    This antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. Similar to other chemokines the protein encoded by this gene inhibits hemopoiesis and stimulates chemotaxis. This protein is chemotactic in vitro for thymocytes and activated T cells, but not for B cells, macrophages, or neutrophils. The cytokine encoded by this gene may also play a role in mediating homing of lymphocytes to secondary lymphoid organs. It is a high affinity functional ligand for chemokine receptor 7 that is expressed on T and B lymphocytes and a known receptor for another member of the cytokine family (small inducible cytokine A19). [provided by RefSeq, Sep 2014] | 
                                
                                
                                    | Form : | 
                                    Lyophlized | 
                                
                                
                                    | Bio-activity : | 
                                    Determined by its ability to chemoattract total lymphocyte population using a concentration range of 10.0-100.0 ng/mL. | 
                                
                                
                                    | Molecular Mass : | 
                                    12 kDa | 
                                
                                
                                    | AA Sequence : | 
                                    MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP | 
                                
                                
                                    | Endotoxin : | 
                                    < 0.1 ng/μg (1 EU/μg) | 
                                
                                
                                    | Purity : | 
                                    > 90% by SDS-PAGE and HPLC | 
                                
                                
                                    | Applications : | 
                                    Functional Study SDS-PAGE | 
                                
                                
                                    | Storage : | 
                                    Store at -20 centigrade on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4 centigrade for 1 month or store at -20 centigrade for 6 months. Aliquot to avoid repeated freezing and thawing. | 
                                
                                
                                    | Storage Buffer : | 
                                    Lyophlized from 2.5% glycine, 0.5% sucrose, 0.01% Tween 80, 5 mM Glutamic acid, pH 4.5 |