Recombinant Human CCL21 Protein

Cat.No. : CCL21-48H
Product Overview : Recombinant Human CCL21 Protein was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 111 amino acid
Description : CCL21 is a human chemokine that recruits normal immune cells and metastasizing tumor cells to lymph nodes through activation of the G protein-coupled receptor CCR7. Originally called SLC or exodus-2, CCL21 is expressed in high endothelial venules of lymph nodes, spleen, and Peyer's patches as well as lymphatic endothelium in peripheral tissues. CCL21 directs the migration of CCR7-expressing lymphocytes and antigen-activated dendritic cells. CCL21 contains 6 conserved cysteines, in contrast to the 4 that are more typical of CC chemokines. CCL21 induces chemotactic migration of thymocytes and activated T-cells, but not B-cells, macrophages, or neutrophils.
Form : Lyophilized
Molecular Mass : 12.2472 kDa
AA Sequence : SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCAD PKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
Endotoxin : Endotoxin-free <0.01 EU/ug
Purity : Purity assessed by HPLC, Mass Spectrometry, and NMR
Storage : Store at -20 to -80 centigrade for 12 months; Store at 4 centigrade for 6 months; Store at RT for 1 month.
tmpcolum67 : C-C motif chemokine ligand 21
Gene Name CCL21 C-C motif chemokine ligand 21 [ Homo sapiens (human) ]
Official Symbol CCL21
Synonyms ECL; SLC; CKb9; TCA4; 6Ckine; SCYA21
Gene ID 6366
mRNA Refseq NM_002989
Protein Refseq NP_002980
MIM 602737
UniProt ID O00585

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL21 Products

Required fields are marked with *

My Review for All CCL21 Products

Required fields are marked with *

0
cart-icon