Recombinant Human CCL21 Protein
Cat.No. : | CCL21-48H |
Product Overview : | Recombinant Human CCL21 Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 111 amino acid |
Description : | CCL21 is a human chemokine that recruits normal immune cells and metastasizing tumor cells to lymph nodes through activation of the G protein-coupled receptor CCR7. Originally called SLC or exodus-2, CCL21 is expressed in high endothelial venules of lymph nodes, spleen, and Peyer's patches as well as lymphatic endothelium in peripheral tissues. CCL21 directs the migration of CCR7-expressing lymphocytes and antigen-activated dendritic cells. CCL21 contains 6 conserved cysteines, in contrast to the 4 that are more typical of CC chemokines. CCL21 induces chemotactic migration of thymocytes and activated T-cells, but not B-cells, macrophages, or neutrophils. |
Form : | Lyophilized |
Molecular Mass : | 12.2472 kDa |
AA Sequence : | SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCAD PKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP |
Endotoxin : | Endotoxin-free <0.01 EU/ug |
Purity : | Purity assessed by HPLC, Mass Spectrometry, and NMR |
Storage : | Store at -20 to -80 centigrade for 12 months; Store at 4 centigrade for 6 months; Store at RT for 1 month. |
tmpcolum67 : | C-C motif chemokine ligand 21 |
Gene Name | CCL21 C-C motif chemokine ligand 21 [ Homo sapiens (human) ] |
Official Symbol | CCL21 |
Synonyms | ECL; SLC; CKb9; TCA4; 6Ckine; SCYA21 |
Gene ID | 6366 |
mRNA Refseq | NM_002989 |
Protein Refseq | NP_002980 |
MIM | 602737 |
UniProt ID | O00585 |
◆ Recombinant Proteins | ||
CCL21-19H | Recombinant Human CCL21 Protein | +Inquiry |
CCL21-513R | Recombinant Rhesus Macaque CCL21 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL21-124H | Active Recombinant Human Chemokine (C-C Motif) Ligand 21, HIgG1 Fc-tagged | +Inquiry |
CCL21-2886H | Recombinant Human CCL21 protein | +Inquiry |
CCL21-122H | Active Recombinant Human Chemokine (C-C Motif) Ligand 21, MIgG2a Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL21-552HCL | Recombinant Human CCL21 cell lysate | +Inquiry |
CCL21-424CCL | Recombinant Cynomolgus CCL21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL21 Products
Required fields are marked with *
My Review for All CCL21 Products
Required fields are marked with *