Recombinant Human CCR2
Cat.No. : | CCR2-27804TH |
Product Overview : | Recombinant fragment (amino acids 1-42) of Human CCR2 with a proprietarytag at the N terminal; 42 amino acids, Predicted MW 30.25 kDa, inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 42 amino acids |
Description : | This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase. This gene is located in the chemokine receptor gene cluster region. Two alternatively spliced transcript variants are expressed by the gene. |
Molecular Weight : | 30.250kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGA |
Gene Name | CCR2 chemokine (C-C motif) receptor 2 [ Homo sapiens ] |
Official Symbol | CCR2 |
Synonyms | CCR2; chemokine (C-C motif) receptor 2; CMKBR2; CC CKR 2; CD192; CKR2; FLJ78302; MCP 1 R; |
Gene ID | 1231 |
MIM | 601267 |
Uniprot ID | P41597 |
Chromosome Location | 3p21 |
Pathway | Chemokine receptors bind chemokines, organism-specific biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; |
◆ Recombinant Proteins | ||
CCR2-3015M | Recombinant Mouse CCR2 protein, hFc-tagged | +Inquiry |
CCR2-3954H | Active Recombinant Human CCR2 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
CCR2-27804TH | Recombinant Human CCR2 | +Inquiry |
RFL10533HF | Recombinant Full Length Human C-C Chemokine Receptor Type 2(Ccr2) (Active) Protein, His-Tagged | +Inquiry |
CCR2-15H | Active Recombinant Human CCR2 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCR2-7696HCL | Recombinant Human CCR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCR2 Products
Required fields are marked with *
My Review for All CCR2 Products
Required fields are marked with *
0
Inquiry Basket