Recombinant Human CCR2

• Cat.No.: CCR2-27804TH
• Product Overview: Recombinant fragment (amino acids 1-42) of Human CCR2 with a proprietarytag at the N terminal; 42 amino acids, Predicted MW 30.25 kDa, inclusive of tag.

Specification

• Description: This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase. This gene is located in the chemokine receptor gene cluster region. Two alternatively spliced transcript variants are expressed by the gene.
• Protein length: 42 amino acids
• Molecular Weight: 30.250kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGA

Gene Information

• Gene Name: CCR2 chemokine (C-C motif) receptor 2 [ Homo sapiens ]
• Official Symbol: CCR2
• Synonyms: CCR2; chemokine (C-C motif) receptor 2; CMKBR2; CC CKR 2; CD192; CKR2; FLJ78302; MCP 1 R
• Gene ID: 1231
• MIM: 601267
• Uniprot ID: P41597
• Chromosome Location: 3p21
• Pathway: Chemokine receptors bind chemokines, organism-specific biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem