Recombinant Human CD274 Protein, GST-Tagged
| Cat.No. : | CD274-0765H |
| Product Overview : | Human CD274 partial ORF (NP_054862, 141 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes an immune inhibitory receptor ligand that is expressed by hematopoietic and non-hematopoietic cells, such as T cells and B cells and various types of tumor cells. The encoded protein is a type I transmembrane protein that has immunoglobulin V-like and C-like domains. Interaction of this ligand with its receptor inhibits T-cell activation and cytokine production. During infection or inflammation of normal tissue, this interaction is important for preventing autoimmunity by maintaining homeostasis of the immune response. In tumor microenvironments, this interaction provides an immune escape for tumor cells through cytotoxic T-cell inactivation. Expression of this gene in tumor cells is considered to be prognostic in many types of human malignancies, including colon cancer and renal cell carcinoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | ILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CD274 CD274 molecule [ Homo sapiens ] |
| Official Symbol | CD274 |
| Synonyms | CD274; CD274 molecule; CD274 antigen, PDCD1LG1, programmed cell death 1 ligand 1; programmed cell death 1 ligand 1; B7 homolog 1; B7 H; B7 H1; B7H1; PD L1; PDL1; CD274 antigen; PDCD1 ligand 1; programmed death ligand 1; B7-H; PD-L1; PDCD1L1; PDCD1LG1; MGC142294; MGC142296; |
| Gene ID | 29126 |
| mRNA Refseq | NM_014143 |
| Protein Refseq | NP_054862 |
| MIM | 605402 |
| UniProt ID | Q9NZQ7 |
| ◆ Recombinant Proteins | ||
| CD274-188MF | Active Recombinant Mouse CD274 Protein, MIgG2a mFc-tagged, FITC conjugated | +Inquiry |
| CD274-130CAF488 | Recombinant Monkey CD274 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| Cd274-593MP | Recombinant Mouse Cd274 protein, Fc-His-tagged, R-PE labeled | +Inquiry |
| Cd274-561RAF647 | Recombinant Rat Cd274 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| CD274-131CB | Recombinant Cynomolgus/Rhesus CD274 protein, His-tagged, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD274-002RCL | Recombinant Rat CD274 cell lysate | +Inquiry |
| CD274-2735HCL | Recombinant Human CD274 cell lysate | +Inquiry |
| CD274-2642MCL | Recombinant Mouse CD274 cell lysate | +Inquiry |
| CD274-914CCL | Recombinant Cynomolgus CD274 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD274 Products
Required fields are marked with *
My Review for All CD274 Products
Required fields are marked with *
