Recombinant Human CD274 Protein, GST-Tagged

Cat.No. : CD274-0765H
Product Overview : Human CD274 partial ORF (NP_054862, 141 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes an immune inhibitory receptor ligand that is expressed by hematopoietic and non-hematopoietic cells, such as T cells and B cells and various types of tumor cells. The encoded protein is a type I transmembrane protein that has immunoglobulin V-like and C-like domains. Interaction of this ligand with its receptor inhibits T-cell activation and cytokine production. During infection or inflammation of normal tissue, this interaction is important for preventing autoimmunity by maintaining homeostasis of the immune response. In tumor microenvironments, this interaction provides an immune escape for tumor cells through cytotoxic T-cell inactivation. Expression of this gene in tumor cells is considered to be prognostic in many types of human malignancies, including colon cancer and renal cell carcinoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]
Molecular Mass : 36.74 kDa
AA Sequence : ILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CD274 CD274 molecule [ Homo sapiens ]
Official Symbol CD274
Synonyms CD274; CD274 molecule; CD274 antigen, PDCD1LG1, programmed cell death 1 ligand 1; programmed cell death 1 ligand 1; B7 homolog 1; B7 H; B7 H1; B7H1; PD L1; PDL1; CD274 antigen; PDCD1 ligand 1; programmed death ligand 1; B7-H; PD-L1; PDCD1L1; PDCD1LG1; MGC142294; MGC142296;
Gene ID 29126
mRNA Refseq NM_014143
Protein Refseq NP_054862
MIM 605402
UniProt ID Q9NZQ7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD274 Products

Required fields are marked with *

My Review for All CD274 Products

Required fields are marked with *

0
cart-icon