Recombinant Human CD33 Protein, Fc/His-tagged, Alexa Fluor 488 conjugated
Cat.No. : | CD33-833HAF488 |
Product Overview : | Alexa Fluor 488 conjugated recombinant human CD33, transcript variant 1, fused with Fc/His tag at C-terminal was expressed in HEK293 cells. |
Availability | May 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc&His |
Form : | Lyophilized |
Molecular Mass : | 55.01 kDa |
AA Sequence : | DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHTSDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKVDHHHHHH |
Endotoxin : | < 0.1 ng/ μg of protein (< 1 EU/ μg). |
Purity : | > 95 % as determined by SDS-PAGE and Coomassie blue staining |
Characteristic : | Disulfide-linked homodimer Labeled with Alexa Fluor 488 via amines Excitation Wavelength: 488 nm Emission Wavelength: 515-545 nm |
Storage Buffer : | Lyophilized from a 0.2 μM filtered solution of 20 mM PB, 150 mM NaCl, 2 mM EDTA, pH 7.2 |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | CD33 CD33 molecule [ Homo sapiens ] |
Official Symbol | CD33 |
Synonyms | CD33; CD33 molecule; CD33 antigen (gp67); myeloid cell surface antigen CD33; FLJ00391; p67; sialic acid binding Ig like lectin 3; SIGLEC 3; SIGLEC3; gp67; sialic acid binding Ig-like lectin 3; sialic acid-binding Ig-like lectin 3; SIGLEC-3; |
Gene ID | 945 |
mRNA Refseq | NM_001082618 |
Protein Refseq | NP_001076087 |
MIM | 159590 |
UniProt ID | P20138 |
◆ Recombinant Proteins | ||
CD33-345H | Recombinant Human CD33 protein, hFc-tagged | +Inquiry |
CD33-181CAF647 | Recombinant Cynomolgus CD33 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
CD33-833HP | Recombinant Human CD33 protein, Fc/His-tagged, R-PE labeled | +Inquiry |
Cd33-832M | Recombinant Mouse Cd33 Protein, MYC/DDK-tagged | +Inquiry |
CD33-313HF | Recombinant Human CD33 Protein, Fc-tagged, FITC conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD33-1808MCL | Recombinant Mouse CD33 cell lysate | +Inquiry |
CD33-978HCL | Recombinant Human CD33 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD33 Products
Required fields are marked with *
My Review for All CD33 Products
Required fields are marked with *
0
Inquiry Basket