Recombinant Human CD33 Protein, Fc/His-tagged, Alexa Fluor 555 conjugated

Cat.No. : CD33-833HAF555
Product Overview : Alexa Fluor 555 conjugated recombinant human CD33, transcript variant 1, fused with Fc/His tag at C-terminal was expressed in HEK293 cells.
Availability September 07, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc&His
Form : Lyophilized
Molecular Mass : 55.01 kDa
AA Sequence : DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHTSDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKVDHHHHHH
Endotoxin : < 0.1 ng/ μg of protein (< 1 EU/ μg).
Purity : > 95 % as determined by SDS-PAGE and Coomassie blue staining
Characteristic : Disulfide-linked homodimer
Labeled with Alexa Fluor 555 via amines
With an excitation and emission maximum of 555/565 nm, Alexa Fluor 555 can be efficiently excited using a 543 nm He-Ne laser line and detected under standard TRITC/Cy3 filters.
Storage Buffer : Lyophilized from a 0.2 μM filtered solution of 20 mM PB, 150 mM NaCl, 2 mM EDTA, pH 7.2
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Conjugation : Alexa Fluor 555
Gene Name CD33 CD33 molecule [ Homo sapiens ]
Official Symbol CD33
Synonyms CD33; CD33 molecule; CD33 antigen (gp67); myeloid cell surface antigen CD33; FLJ00391; p67; sialic acid binding Ig like lectin 3; SIGLEC 3; SIGLEC3; gp67; sialic acid binding Ig-like lectin 3; sialic acid-binding Ig-like lectin 3; SIGLEC-3;
Gene ID 945
mRNA Refseq NM_001082618
Protein Refseq NP_001076087
MIM 159590
UniProt ID P20138

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD33 Products

Required fields are marked with *

My Review for All CD33 Products

Required fields are marked with *

0
cart-icon
0
compare icon