Recombinant Human CD59 protein, T7/His-tagged
Cat.No. : | CD59-76H |
Product Overview : | Recombinant human CD59 extracellular domain cDNA (26 - 102 aa) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 26-102 a.a. |
Form : | 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFALVQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEH CNFNDVTTRLRENELTYYCCRKDLCNFNEQLEN |
Purity : | >90% by SDS-PAGE |
Applications : | 1. Protein can be used as coating matrix protein for CD59 mediated cell functions and differentiation regulation study in vitro.2. As potential disease diagnosis biomarker protein for breast cancer or systemic lupus.3. As antigen for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | CD59 CD59 molecule, complement regulatory protein [ Homo sapiens ] |
Official Symbol | CD59 |
Synonyms | CD59; CD59 molecule, complement regulatory protein; CD59 antigen p18 20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344) , CD59 antigen, complement regulatory protein , MIC11, MIN1, MIN2, MIN3, MSK21; CD59 glycoprotein; 16. |
Gene ID | 966 |
mRNA Refseq | NM_000611 |
Protein Refseq | NP_000602 |
MIM | 107271 |
UniProt ID | P13987 |
Chromosome Location | 11p13 |
Pathway | Arf6 trafficking events, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; |
Function | protein binding; |
◆ Recombinant Proteins | ||
CD59-6830P | Recombinant Pig CD59 protein, His & T7-tagged | +Inquiry |
CD59-15902H | Recombinant Human CD59, His-tagged | +Inquiry |
CD59-2667H | Recombinant Human CD59 protein, GST-tagged | +Inquiry |
CD59-3116H | Recombinant Human CD59 Protein, MYC/DDK-tagged | +Inquiry |
CD59-746R | Recombinant Rhesus monkey CD59 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD59-1968HCL | Recombinant Human CD59 cell lysate | +Inquiry |
CD59-1365RCL | Recombinant Rat CD59 cell lysate | +Inquiry |
CD59-1019CCL | Recombinant Cynomolgus CD59 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD59 Products
Required fields are marked with *
My Review for All CD59 Products
Required fields are marked with *
0
Inquiry Basket