"CD59" Related Products

Expand
Expand
Expand

Recombinant Human CD59 protein, T7/His-tagged

Cat.No.: CD59-76H
Product Overview: Recombinant human CD59 extracellular domain cDNA (26 - 102 aa) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFALVQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEH CNFNDVTTRLRENELTYYCCRKDLCNFNEQLEN
Purity: >90% by SDS-PAGE
Applications: 1. Protein can be used as coating matrix protein for CD59 mediated cell functions and differentiation regulation study in vitro.2. As potential disease diagnosis biomarker protein for breast cancer or systemic lupus.3. As antigen for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: CD59 CD59 molecule, complement regulatory protein [ Homo sapiens ]
Official Symbol: CD59
Synonyms: CD59; CD59 molecule, complement regulatory protein; CD59 antigen p18 20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344) , CD59 antigen, complement regulatory protein , MIC11, MIN1, MIN2, MIN3, MSK21; CD59 glycoprotein; 16.
Gene ID: 966
mRNA Refseq: NM_000611
Protein Refseq: NP_000602
MIM: 107271
UniProt ID: P13987
Chromosome Location: 11p13
Pathway: Arf6 trafficking events, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem;
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.