Recombinant Human CD59 protein, T7/His-tagged

Cat.No. : CD59-76H
Product Overview : Recombinant human CD59 extracellular domain cDNA (26 - 102 aa) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 26-102 a.a.
Form : 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFALVQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEH CNFNDVTTRLRENELTYYCCRKDLCNFNEQLEN
Purity : >90% by SDS-PAGE
Applications : 1. Protein can be used as coating matrix protein for CD59 mediated cell functions and differentiation regulation study in vitro.2. As potential disease diagnosis biomarker protein for breast cancer or systemic lupus.3. As antigen for specific antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name CD59 CD59 molecule, complement regulatory protein [ Homo sapiens ]
Official Symbol CD59
Synonyms CD59; CD59 molecule, complement regulatory protein; CD59 antigen p18 20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344) , CD59 antigen, complement regulatory protein , MIC11, MIN1, MIN2, MIN3, MSK21; CD59 glycoprotein; 16.
Gene ID 966
mRNA Refseq NM_000611
Protein Refseq NP_000602
MIM 107271
UniProt ID P13987
Chromosome Location 11p13
Pathway Arf6 trafficking events, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem;
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD59 Products

Required fields are marked with *

My Review for All CD59 Products

Required fields are marked with *

0
cart-icon
0
compare icon