Recombinant Human CD59 protein, T7/His-tagged
| Cat.No. : | CD59-76H |
| Product Overview : | Recombinant human CD59 extracellular domain cDNA (26 - 102 aa) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 26-102 a.a. |
| Form : | 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFALVQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEH CNFNDVTTRLRENELTYYCCRKDLCNFNEQLEN |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. Protein can be used as coating matrix protein for CD59 mediated cell functions and differentiation regulation study in vitro.2. As potential disease diagnosis biomarker protein for breast cancer or systemic lupus.3. As antigen for specific antibody production. |
| Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
| Gene Name | CD59 CD59 molecule, complement regulatory protein [ Homo sapiens ] |
| Official Symbol | CD59 |
| Synonyms | CD59; CD59 molecule, complement regulatory protein; CD59 antigen p18 20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344) , CD59 antigen, complement regulatory protein , MIC11, MIN1, MIN2, MIN3, MSK21; CD59 glycoprotein; 16. |
| Gene ID | 966 |
| mRNA Refseq | NM_000611 |
| Protein Refseq | NP_000602 |
| MIM | 107271 |
| UniProt ID | P13987 |
| Chromosome Location | 11p13 |
| Pathway | Arf6 trafficking events, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; |
| Function | protein binding; |
| ◆ Recombinant Proteins | ||
| CD59-6832R | Recombinant Rabbit CD59 protein, His & S-tagged | +Inquiry |
| CD59-572R | Recombinant Rhesus Macaque CD59 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CD59-2667H | Recombinant Human CD59 protein, GST-tagged | +Inquiry |
| Cd59-8764R | Recombinant Rat Cd59 protein(Met1-Asn100), hFc-tagged | +Inquiry |
| CD59-5367H | Recombinant Human CD59 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD59-1019CCL | Recombinant Cynomolgus CD59 cell lysate | +Inquiry |
| CD59-1365RCL | Recombinant Rat CD59 cell lysate | +Inquiry |
| CD59-1968HCL | Recombinant Human CD59 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD59 Products
Required fields are marked with *
My Review for All CD59 Products
Required fields are marked with *




