Recombinant Human CD63 Full Length Transmembrane protein, His-tagged
Cat.No. : | CD63-4837H |
Product Overview : | Recombinant Human CD63 protein(P08962)(2-238aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-238aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.5 kDa |
AA Sequence : | AVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | CD63 CD63 molecule [ Homo sapiens ] |
Official Symbol | CD63 |
Synonyms | CD63; CD63 molecule; CD63 antigen (melanoma 1 antigen) , MLA1; CD63 antigen; ME491; TSPAN30; tspan-30; granulophysin; tetraspanin-30; melanoma-associated antigen MLA1; CD63 antigen (melanoma 1 antigen); melanoma-associated antigen ME491; ocular melanoma-associated antigen; lysosomal-associated membrane protein 3; lysosome-associated membrane glycoprotein 3; MLA1; LAMP-3; OMA81H; |
Gene ID | 967 |
mRNA Refseq | NM_001257389 |
Protein Refseq | NP_001244318 |
MIM | 155740 |
UniProt ID | P08962 |
◆ Recombinant Proteins | ||
CD63-1286H | Recombinant Human CD63 Protein (Ala103-Val203), C-His tagged | +Inquiry |
RFL36047RF | Recombinant Full Length Rat Cd63 Antigen(Cd63) Protein, His-Tagged | +Inquiry |
CD63-573R | Recombinant Rhesus Macaque CD63 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD63-151H | Recombinant Human CD63 Protein, DYKDDDDK-tagged | +Inquiry |
CD63-1324H | Recombinant Human CD63 Protein (Ala103-Val203), N-GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD63-001RCL | Recombinant Rat CD63 cell lysate | +Inquiry |
CD63-814CCL | Recombinant Cynomolgus CD63 cell lysate | +Inquiry |
CD63-1553SCL | Recombinant Sus scrofa (Pig) CD63 cell lysate | +Inquiry |
CD63-1913HCL | Recombinant Human CD63 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD63 Products
Required fields are marked with *
My Review for All CD63 Products
Required fields are marked with *