Recombinant Human CD82 Protein, C-His-tagged
Cat.No. : | CD82-146H |
Product Overview : | Recombinant Human CD82 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | CD82 (KAI1) belongs to the tetraspanin family, which is characterized by four transmembrane domains, one short extracellular domain (ECL1), and one long extracellular domain (ECL2). CD82 does not have enzymatic activity and appears to function by regulating the trafficking of other proteins and organization of the cell membrane. CD82 was originally described as a costimulator for T cells that directly associates with CD4 and CD8, and was subsequently identified during a screen as a metastasis suppressor in prostate cancer. CD82 has since been found to act as a metastasis suppressor in a variety of cancers, and its downregulation is associated with poor prognosis in research studies. CD82 suppresses metastasis through multiple mechanisms including inhibition of cell motility and invasion by modulating c-Met and the urokinase plasminogen activator surface receptor (uPAR), as well as promotion of homotypic cell-cell adhesion by stabilizing interactions between E-cadherin and β-catenin. |
Molecular Mass : | ~13 kDa |
AA Sequence : | GKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENL |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CD82 CD82 antigen (R2 leukocyte antigen, antigen detected by monoclonal [ Homo sapiens (human) ] |
Official Symbol | CD82 |
Synonyms | CD82; CD82 antigen (R2 leukocyte antigen, antigen detected; CD82 antigen (R2 leukocyte antigen, antigen detected by monoclonal; SAR2; |
Gene ID | 3732 |
mRNA Refseq | NM_002231 |
Protein Refseq | NP_002222 |
MIM | 600623 |
UniProt ID | P27701 |
◆ Recombinant Proteins | ||
RFL2400MF | Recombinant Full Length Mouse Cd82 Antigen(Cd82) Protein, His-Tagged | +Inquiry |
CD82-3970H | Recombinant Human CD82(Gly103-Gln225) Protein, N-Fc-tagged | +Inquiry |
CD82-3721H | Recombinant Human CD82 Protein (Gly111-Leu228), C-His tagged | +Inquiry |
Cd82-2674M | Recombinant Mouse Cd82 protein, His-SUMO-tagged | +Inquiry |
RFL11281RF | Recombinant Full Length Rat Cd82 Antigen(Cd82) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD82-1960HCL | Recombinant Human CD82 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD82 Products
Required fields are marked with *
My Review for All CD82 Products
Required fields are marked with *
0
Inquiry Basket