Recombinant Human CDH5 Protein, GST-Tagged
| Cat.No. : | CDH5-0991H |
| Product Overview : | Human CDH5 partial ORF (NP_001786, 51 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a classical cadherin of the cadherin superfamily. The encoded preproprotein is proteolytically processed to generate the mature glycoprotein. This calcium-dependent cell-cell adhesion molecule is comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Functioning as a classical cadherin by imparting to cells the ability to adhere in a homophilic manner, this protein plays a role in endothelial adherens junction assembly and maintenance. This gene is located in a gene cluster in a region on the long arm of chromosome 16 that is involved in loss of heterozygosity events in breast and prostate cancer. [provided by RefSeq, Nov 2015] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | WNQMHIDEEKNTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETPSSFTIKVHDVNDNWPV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CDH5 cadherin 5, type 2 (vascular endothelium) [ Homo sapiens ] |
| Official Symbol | CDH5 |
| Synonyms | CDH5; cadherin 5, type 2 (vascular endothelium); cadherin 5, type 2, VE cadherin (vascular epithelium); cadherin-5; 7B4; CD144; VE cadherin; 7B4 antigen; VE-cadherin; cd144 antigen; endothelial-specific cadherin; vascular endothelial cadherin; cadherin 5, type 2, VE-cadherin (vascular epithelium); FLJ17376; |
| Gene ID | 1003 |
| mRNA Refseq | NM_001795 |
| Protein Refseq | NP_001786 |
| MIM | 601120 |
| UniProt ID | P33151 |
| ◆ Recombinant Proteins | ||
| CDH5-3677H | Recombinant Human CDH5 protein, GST-tagged | +Inquiry |
| CDH5-1182Z | Recombinant Zebrafish CDH5 | +Inquiry |
| CDH5-31200TH | Recombinant Human CDH5 | +Inquiry |
| RFL7349SF | Recombinant Full Length Pig Cadherin-5(Cdh5) Protein, His-Tagged | +Inquiry |
| CDH5-003H | Recombinant Human CDH5 Protein, C-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CDH5-1201RCL | Recombinant Rat CDH5 cell lysate | +Inquiry |
| CDH5-2213HCL | Recombinant Human CDH5 cell lysate | +Inquiry |
| CDH5-2570MCL | Recombinant Mouse CDH5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDH5 Products
Required fields are marked with *
My Review for All CDH5 Products
Required fields are marked with *
