Recombinant Human CDH5 Protein, GST-Tagged

Cat.No. : CDH5-0991H
Product Overview : Human CDH5 partial ORF (NP_001786, 51 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a classical cadherin of the cadherin superfamily. The encoded preproprotein is proteolytically processed to generate the mature glycoprotein. This calcium-dependent cell-cell adhesion molecule is comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Functioning as a classical cadherin by imparting to cells the ability to adhere in a homophilic manner, this protein plays a role in endothelial adherens junction assembly and maintenance. This gene is located in a gene cluster in a region on the long arm of chromosome 16 that is involved in loss of heterozygosity events in breast and prostate cancer. [provided by RefSeq, Nov 2015]
Molecular Mass : 36.74 kDa
AA Sequence : WNQMHIDEEKNTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETPSSFTIKVHDVNDNWPV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDH5 cadherin 5, type 2 (vascular endothelium) [ Homo sapiens ]
Official Symbol CDH5
Synonyms CDH5; cadherin 5, type 2 (vascular endothelium); cadherin 5, type 2, VE cadherin (vascular epithelium); cadherin-5; 7B4; CD144; VE cadherin; 7B4 antigen; VE-cadherin; cd144 antigen; endothelial-specific cadherin; vascular endothelial cadherin; cadherin 5, type 2, VE-cadherin (vascular epithelium); FLJ17376;
Gene ID 1003
mRNA Refseq NM_001795
Protein Refseq NP_001786
MIM 601120
UniProt ID P33151

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDH5 Products

Required fields are marked with *

My Review for All CDH5 Products

Required fields are marked with *

0
cart-icon
0
compare icon