Recombinant Human CEACAM8 protein, T7/His-tagged
| Cat.No. : | CEACAM8-45H |
| Product Overview : | Recombinant human CD67 extracellular domain cDNA (35 - 320 aa, derived from BC026263) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 35-320 a.a. |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIG YVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNP VEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTL NVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSAT GRNRTTVRMITVSD |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used coating matrix protein for in vitro granulocytes differentiation regulations study.2. May be used for protein-protein interaction assay development.3. Potential diagnostic biomarker protein for acute myolofibrosis.4. As antigen for specific antibody production. |
| Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
| Gene Name | CEACAM8 carcinoembryonic antigen-related cell adhesion molecule 8 [ Homo sapiens ] |
| Official Symbol | CEACAM8 |
| Synonyms | CEACAM8; carcinoembryonic antigen-related cell adhesion molecule 8; CGM6; CD66b; CD67 antigen; carcinoembryonic antigen CGM6; non-specific cross-reacting antigen NCA-95; carcinoembryonic antigen gene family member 6; CD67; NCA-95; |
| Gene ID | 1088 |
| mRNA Refseq | NM_001816 |
| Protein Refseq | NP_001807 |
| MIM | |
| UniProt ID | P31997 |
| Chromosome Location | 19q13.2 |
| ◆ Recombinant Proteins | ||
| CEACAM8-0849H | Recombinant Human CEACAM8 Protein (Gln35-Asp320), His tagged | +Inquiry |
| CEACAM8-3276HF | Recombinant Full Length Human CEACAM8 Protein, GST-tagged | +Inquiry |
| CEACAM8-45H | Recombinant Human CEACAM8 protein, T7/His-tagged | +Inquiry |
| CEACAM8-69HF | Recombinant Full Length Human CEACAM8 Protein | +Inquiry |
| CEACAM8-1098H | Recombinant Human CEACAM8 Protein, GST-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CEACAM8-2246HCL | Recombinant Human CEACAM8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEACAM8 Products
Required fields are marked with *
My Review for All CEACAM8 Products
Required fields are marked with *
