Recombinant Human CRIP2 Protein, GST-tagged

Cat.No. : CRIP2-1875H
Product Overview : Human CRIP2 full-length ORF ( NP_001303, 1 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a putative transcription factor with two LIM zinc-binding domains. The encoded protein may participate in the differentiation of smooth muscle tissue. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]
Molecular Mass : 48.51 kDa
AA Sequence : MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIGGAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CRIP2 cysteine-rich protein 2 [ Homo sapiens ]
Official Symbol CRIP2
Synonyms CRIP2; cysteine-rich protein 2; CRP2; ESP1; CRP-2; Cystein-rich intestinal protein; CRIP;
Gene ID 1397
mRNA Refseq NM_001312
Protein Refseq NP_001303
MIM 601183
UniProt ID P52943

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CRIP2 Products

Required fields are marked with *

My Review for All CRIP2 Products

Required fields are marked with *

0
cart-icon
0
compare icon