Recombinant Human CTSD protein(71-410 aa), C-His-tagged
Cat.No. : | CTSD-2582H |
Product Overview : | Recombinant Human CTSD protein(P07339)(71-410 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 71-410 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | GPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAAR |
Gene Name | CTSD cathepsin D [ Homo sapiens ] |
Official Symbol | CTSD |
Synonyms | CTSD; cathepsin D; cathepsin D (lysosomal aspartyl protease) , CPSD; ceroid lipofuscinosis; neuronal 10; CLN10; lysosomal aspartyl protease; lysosomal aspartyl peptidase; ceroid-lipofuscinosis, neuronal 10; CPSD; MGC2311; |
Gene ID | 1509 |
mRNA Refseq | NM_001909 |
Protein Refseq | NP_001900 |
MIM | 116840 |
UniProt ID | P07339 |
◆ Recombinant Proteins | ||
CTSD-2758H | Recombinant Human CTSD protein, GST-tagged | +Inquiry |
CTSD-913R | Recombinant Rhesus Macaque CTSD Protein, His (Fc)-Avi-tagged | +Inquiry |
CTSD-2752H | Recombinant Human CTSD Protein, His (Fc)-Avi-tagged | +Inquiry |
CTSD-1649H | Active Recombinant Human CTSD, His-tagged | +Inquiry |
CTSD-2103H | Recombinant Human CTSD Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CTSD-26411TH | Active Native Human Cathepsin D protein | +Inquiry |
CTSD-27858TH | Native Human CTSD | +Inquiry |
CTSD-1648H | Active Native Human Cathepsin D | +Inquiry |
CTSD-189H | Active Native Human Cathepsin D | +Inquiry |
CTSD-5325D | Active Native Human CTSD protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTSD-3023MCL | Recombinant Mouse CTSD cell lysate | +Inquiry |
CTSD-1735HCL | Recombinant Human CTSD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTSD Products
Required fields are marked with *
My Review for All CTSD Products
Required fields are marked with *