Recombinant Human CTSD protein(71-410 aa), C-His-tagged
| Cat.No. : | CTSD-2582H |
| Product Overview : | Recombinant Human CTSD protein(P07339)(71-410 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 71-410 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | GPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAAR |
| Gene Name | CTSD cathepsin D [ Homo sapiens ] |
| Official Symbol | CTSD |
| Synonyms | CTSD; cathepsin D; cathepsin D (lysosomal aspartyl protease) , CPSD; ceroid lipofuscinosis; neuronal 10; CLN10; lysosomal aspartyl protease; lysosomal aspartyl peptidase; ceroid-lipofuscinosis, neuronal 10; CPSD; MGC2311; |
| Gene ID | 1509 |
| mRNA Refseq | NM_001909 |
| Protein Refseq | NP_001900 |
| MIM | 116840 |
| UniProt ID | P07339 |
| ◆ Recombinant Proteins | ||
| Ctsd-4222R | Recombinant Rat Ctsd protein, His&Myc-tagged | +Inquiry |
| Ctsd-6762R | Recombinant Rat Ctsd protein, His & GST-tagged | +Inquiry |
| Ctsd-280M | Recombinant Mouse Ctsd, His tagged | +Inquiry |
| CTSD-913R | Recombinant Rhesus Macaque CTSD Protein, His (Fc)-Avi-tagged | +Inquiry |
| CTSD-4669H | Recombinant Human CTSD protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CTSD-26411TH | Active Native Human Cathepsin D protein | +Inquiry |
| CTSD-27858TH | Native Human CTSD | +Inquiry |
| CTSD-189H | Active Native Human Cathepsin D | +Inquiry |
| CTSD-1648H | Active Native Human Cathepsin D | +Inquiry |
| CTSD-5325D | Active Native Human CTSD protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CTSD-3023MCL | Recombinant Mouse CTSD cell lysate | +Inquiry |
| CTSD-1735HCL | Recombinant Human CTSD cell lysate | +Inquiry |
| CTSD-130HKCL | Human CTSD Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTSD Products
Required fields are marked with *
My Review for All CTSD Products
Required fields are marked with *
