Recombinant Human CX3CR1 Protein, GST-tagged

• Cat.No.: CX3CR1-2150H
• Product Overview: Human CX3CR1 full-length ORF ( AAH28078.1, 1 a.a. - 355 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Fractalkine is a transmembrane protein and chemokine involved in the adhesion and migration of leukocytes. The protein encoded by this gene is a receptor for fractalkine. The encoded protein also is a coreceptor for HIV-1, and some variations in this gene lead to increased susceptibility to HIV-1 infection and rapid progression to AIDS. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jan 2010]
• Molecular Mass: 64.79 kDa
• AA Sequence: MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVFFLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKFRRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CX3CR1 chemokine (C-X3-C motif) receptor 1 [ Homo sapiens ]
• Official Symbol: CX3CR1
• Synonyms: CX3CR1; chemokine (C-X3-C motif) receptor 1; chemokine (C X3 C) receptor 1 , CMKBRL1, GPR13; CX3C chemokine receptor 1; CCRL1; CMKDR1; V28; CMK-BRL1; CMK-BRL-1; C-X3-C CKR-1; fractalkine receptor; G protein-coupled receptor 13; G-protein coupled receptor 13; chemokine (C-X3-C) receptor 1; beta chemokine receptor-like 1; chemokine (C-C) receptor-like 1; GPR13; GPRV28; CMKBRL1
• Gene ID: 1524
• mRNA Refseq: NM_001171171
• Protein Refseq: NP_001164642
• MIM: 601470
• UniProt ID: P49238