Recombinant Human CXCL13 Protein

Cat.No. : CXCL13-58H
Product Overview : Recombinant Human CXCL13 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : B cell-attracting chemokine 1 (BCA-1), also known as CXCL13, is expressed at high levels in lymphoid tissues, such as the spleen, lymph nodes, and Peyer’s patches. BCA-1 activates signaling through the receptor Burkitt lymphoma receptor 1 (BLR1) to chemoattract B cells.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 10.2 kDa (86 aa)
AA Sequence : VLEVYYTSLRCRVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name CXCL13 C-X-C motif chemokine ligand 13 [ Homo sapiens (human) ]
Official Symbol CXCL13
Synonyms CXCL13; C-X-C motif chemokine ligand 13; BLC; BCA1; ANGIE; BCA-1; BLR1L; ANGIE2; SCYB13; C-X-C motif chemokine 13; B-cell chemoattractant; B-cell-attracting chemokine 1; B-cell-homing chemokine (ligand for Burkitt's lymphoma receptor-1); B-lymphocyte chemoattractant; CXC chemokine BLC; b cell-attracting chemokine 1; b lymphocyte chemoattractant; chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant); small inducible cytokine B subfamily (Cys-X-Cys motif), member 13 (B-cell chemoattractant); small-inducible cytokine B13
Gene ID 10563
mRNA Refseq NM_006419
Protein Refseq NP_006410
MIM 605149
UniProt ID Q53X90

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL13 Products

Required fields are marked with *

My Review for All CXCL13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon