Recombinant Human CXCL13 Protein
| Cat.No. : | CXCL13-58H |
| Product Overview : | Recombinant Human CXCL13 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Description : | B cell-attracting chemokine 1 (BCA-1), also known as CXCL13, is expressed at high levels in lymphoid tissues, such as the spleen, lymph nodes, and Peyer’s patches. BCA-1 activates signaling through the receptor Burkitt lymphoma receptor 1 (BLR1) to chemoattract B cells. |
| Bio-activity : | No biological activity data is available at this time. |
| Molecular Mass : | Monomer, 10.2 kDa (86 aa) |
| AA Sequence : | VLEVYYTSLRCRVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP |
| Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
| Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
| Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
| Storage : | Storage Prior to Reconstitution: -20 centigrade |
| Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
| Reconstitution : | Sterile water at 0.1 mg/mL |
| Shipping : | Room temperature |
| Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
| Gene Name | CXCL13 C-X-C motif chemokine ligand 13 [ Homo sapiens (human) ] |
| Official Symbol | CXCL13 |
| Synonyms | CXCL13; C-X-C motif chemokine ligand 13; BLC; BCA1; ANGIE; BCA-1; BLR1L; ANGIE2; SCYB13; C-X-C motif chemokine 13; B-cell chemoattractant; B-cell-attracting chemokine 1; B-cell-homing chemokine (ligand for Burkitt's lymphoma receptor-1); B-lymphocyte chemoattractant; CXC chemokine BLC; b cell-attracting chemokine 1; b lymphocyte chemoattractant; chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant); small inducible cytokine B subfamily (Cys-X-Cys motif), member 13 (B-cell chemoattractant); small-inducible cytokine B13 |
| Gene ID | 10563 |
| mRNA Refseq | NM_006419 |
| Protein Refseq | NP_006410 |
| MIM | 605149 |
| UniProt ID | Q53X90 |
| ◆ Recombinant Proteins | ||
| Cxcl13-149M | Active Recombinant Mouse Cxcl13 Protein | +Inquiry |
| CXCL13-1695H | Recombinant Human CXCL13 Protein (Val23-Arg94), N-His tagged | +Inquiry |
| CXCL13-1322R | Recombinant Rhesus CXCL13 protein | +Inquiry |
| CXCL13-124H | Active Recombinant Human Chemokine (C-X-C motif) Ligand 13, MIgG2a Fc-tagged | +Inquiry |
| CXCL13-2437H | Recombinant human CXCL13, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXCL13-7170HCL | Recombinant Human CXCL13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL13 Products
Required fields are marked with *
My Review for All CXCL13 Products
Required fields are marked with *
