Recombinant Human CXCR3 protein, His-GST-tagged

• Cat.No.: CXCR3-2778H
• Product Overview: Recombinant Human CXCR3 protein(P49682)(4-50aa), fused to N-terminal His tag and GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His-GST
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 36.6 kDa
• Protein length: 4-50aa
• AA Sequence: EVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLN
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CXCR3 chemokine (C-X-C motif) receptor 3 [ Homo sapiens ]
• Official Symbol: CXCR3
• Synonyms: CXCR3; chemokine (C-X-C motif) receptor 3; G protein coupled receptor 9 , GPR9; C-X-C chemokine receptor type 3; CD183; CKR L2; CMKAR3; IP10 R; MigR; CXC-R3; CXCR-3; Mig receptor; IP10 receptor; IP-10 receptor; G protein-coupled receptor 9; chemokine (C-X-C) receptor 3; interferon-inducible protein 10 receptor; GPR9; CD182; Mig-R; CKR-L2; IP10-R
• Gene ID: 2833
• mRNA Refseq: NM_001142797
• Protein Refseq: NP_001136269
• MIM: 300574
• UniProt ID: P49682