Recombinant Human CXCR3 protein, His-GST-tagged
| Cat.No. : | CXCR3-2778H |
| Product Overview : | Recombinant Human CXCR3 protein(P49682)(4-50aa), fused to N-terminal His tag and GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST&His |
| Protein Length : | 4-50aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 36.6 kDa |
| AA Sequence : | EVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLN |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CXCR3 chemokine (C-X-C motif) receptor 3 [ Homo sapiens ] |
| Official Symbol | CXCR3 |
| Synonyms | CXCR3; chemokine (C-X-C motif) receptor 3; G protein coupled receptor 9 , GPR9; C-X-C chemokine receptor type 3; CD183; CKR L2; CMKAR3; IP10 R; MigR; CXC-R3; CXCR-3; Mig receptor; IP10 receptor; IP-10 receptor; G protein-coupled receptor 9; chemokine (C-X-C) receptor 3; interferon-inducible protein 10 receptor; GPR9; CD182; Mig-R; CKR-L2; IP10-R; |
| Gene ID | 2833 |
| mRNA Refseq | NM_001142797 |
| Protein Refseq | NP_001136269 |
| MIM | 300574 |
| UniProt ID | P49682 |
| ◆ Cell & Tissue Lysates | ||
| CXCR3-7162HCL | Recombinant Human CXCR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCR3 Products
Required fields are marked with *
My Review for All CXCR3 Products
Required fields are marked with *
