Recombinant Human CXCR3 protein, His-GST-tagged
Cat.No. : | CXCR3-2778H |
Product Overview : | Recombinant Human CXCR3 protein(P49682)(4-50aa), fused to N-terminal His tag and GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Human |
Tag : | His&GST |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.6 kDa |
Protein length : | 4-50aa |
AA Sequence : | EVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLN |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name : | CXCR3 chemokine (C-X-C motif) receptor 3 [ Homo sapiens ] |
Official Symbol : | CXCR3 |
Synonyms : | CXCR3; chemokine (C-X-C motif) receptor 3; G protein coupled receptor 9 , GPR9; C-X-C chemokine receptor type 3; CD183; CKR L2; CMKAR3; IP10 R; MigR; CXC-R3; CXCR-3; Mig receptor; IP10 receptor; IP-10 receptor; G protein-coupled receptor 9; chemokine (C-X-C) receptor 3; interferon-inducible protein 10 receptor; GPR9; CD182; Mig-R; CKR-L2; IP10-R; |
Gene ID : | 2833 |
mRNA Refseq : | NM_001142797 |
Protein Refseq : | NP_001136269 |
MIM : | 300574 |
UniProt ID : | P49682 |
Products Types
◆ Recombinant Protein | ||
CXCR3-1353R | Recombinant Rat CXCR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cxcr3-888R | Recombinant Rat Cxcr3 Protein, His-tagged | +Inquiry |
CXCR3-939R | Recombinant Rhesus Macaque CXCR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CXCR3-261H | Recombinant Human CXCR3 protein, His-tagged | +Inquiry |
CXCR3-16H | Recombinant Human CXCR3 protein, GST-tagged | +Inquiry |
◆ Lysates | ||
CXCR3-7162HCL | Recombinant Human CXCR3 293 Cell Lysate | +Inquiry |
◆ Assay kits | ||
Kit-1196 | cAMP CXCR3 CHO-K1 GPCR Assay Kit | +Inquiry |
Kit-1194 | CXCR3 Activated GPCR Internalization Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Reviews
- Q&As
Customer Reviews (3)
Write a reviewThe continuous innovation and improvements made by the manufacturer indicated a promising future for the product.
Inclusion of the product consistently led to a significant upregulation of target protein expression levels.
We were excited about the product's role in driving future discoveries in our field of study.
Q&As (7)
Ask a questionThe primary role of chemokines and their receptors, including CXCR3, is in the recruitment, activation, and differentiation of immune cells.
There are three variant isoforms of CXCR3: CXCR3A, CXCR3B, and CXCR3alt.
The ligands associated with the chemokine receptor CXCR3 are CXCL9, CXCL10, and CXCL11, and they play key roles during interferon-induced inflammatory responses.
The relative contributions of different CXCR3 chemokines and the three variant isoforms to the inflammatory process in human skin require further investigation.
The review focuses on the biology of CXCR3 and its associated ligands, with particular emphasis on their roles in the skin during inflammation and carcinogenesis.
In skin cancers, the CXCR3 receptor can play a dual role. Its expression on tumor cells can lead to cancer metastasis, while expression on immune cells can promote anti-tumor immune responses.
The expression of CXCL9, CXCL10, and CXCL11 is driven by inflammation of the skin resulting from infections or autoimmune disease, leading to the recruitment of effector, CXCR3+ T cells from the circulation.
Ask a Question for All CXCR3 Products
Required fields are marked with *
My Review for All CXCR3 Products
Required fields are marked with *
Inquiry Basket