Recombinant Human CXCR3 protein, His-GST-tagged

Cat.No. : CXCR3-2778H
Product Overview : Recombinant Human CXCR3 protein(P49682)(4-50aa), fused to N-terminal His tag and GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His
Protein Length : 4-50aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 36.6 kDa
AA Sequence : EVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLN
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name CXCR3 chemokine (C-X-C motif) receptor 3 [ Homo sapiens ]
Official Symbol CXCR3
Synonyms CXCR3; chemokine (C-X-C motif) receptor 3; G protein coupled receptor 9 , GPR9; C-X-C chemokine receptor type 3; CD183; CKR L2; CMKAR3; IP10 R; MigR; CXC-R3; CXCR-3; Mig receptor; IP10 receptor; IP-10 receptor; G protein-coupled receptor 9; chemokine (C-X-C) receptor 3; interferon-inducible protein 10 receptor; GPR9; CD182; Mig-R; CKR-L2; IP10-R;
Gene ID 2833
mRNA Refseq NM_001142797
Protein Refseq NP_001136269
MIM 300574
UniProt ID P49682

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCR3 Products

Required fields are marked with *

My Review for All CXCR3 Products

Required fields are marked with *

0
cart-icon