Recombinant Human CXCR3 protein, His-GST-tagged

Cat.No. : CXCR3-2778H
Product Overview : Recombinant Human CXCR3 protein(P49682)(4-50aa), fused to N-terminal His tag and GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Human
Tag : His&GST
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 36.6 kDa
Protein length : 4-50aa
AA Sequence : EVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLN
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name : CXCR3 chemokine (C-X-C motif) receptor 3 [ Homo sapiens ]
Official Symbol : CXCR3
Synonyms : CXCR3; chemokine (C-X-C motif) receptor 3; G protein coupled receptor 9 , GPR9; C-X-C chemokine receptor type 3; CD183; CKR L2; CMKAR3; IP10 R; MigR; CXC-R3; CXCR-3; Mig receptor; IP10 receptor; IP-10 receptor; G protein-coupled receptor 9; chemokine (C-X-C) receptor 3; interferon-inducible protein 10 receptor; GPR9; CD182; Mig-R; CKR-L2; IP10-R;
Gene ID : 2833
mRNA Refseq : NM_001142797
Protein Refseq : NP_001136269
MIM : 300574
UniProt ID : P49682

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Reviews
  • Q&As

Customer Reviews (3)

Write a review
Reviews
12/11/2019

    The continuous innovation and improvements made by the manufacturer indicated a promising future for the product.

    07/30/2019

      Inclusion of the product consistently led to a significant upregulation of target protein expression levels.

      12/19/2016

        We were excited about the product's role in driving future discoveries in our field of study.

        Q&As (7)

        Ask a question
        What is the primary role of chemokines and their receptors, particularly CXCR3, in immune cell processes? 10/18/2020

        The primary role of chemokines and their receptors, including CXCR3, is in the recruitment, activation, and differentiation of immune cells.

        How many variant isoforms of CXCR3 exist, and what are their names? 03/20/2020

        There are three variant isoforms of CXCR3: CXCR3A, CXCR3B, and CXCR3alt.

        Which ligands are associated with the chemokine receptor CXCR3, and what are their roles during interferon-induced inflammatory responses? 01/18/2019

        The ligands associated with the chemokine receptor CXCR3 are CXCL9, CXCL10, and CXCL11, and they play key roles during interferon-induced inflammatory responses.

        What aspect of the inflammatory process in human skin involving CXCR3 chemokines and isoforms requires further investigation, according to the information provided? 12/18/2018

        The relative contributions of different CXCR3 chemokines and the three variant isoforms to the inflammatory process in human skin require further investigation.

        What is the focus of the review regarding CXCR3, its ligands, and their role in skin during inflammation and carcinogenesis? 05/16/2018

        The review focuses on the biology of CXCR3 and its associated ligands, with particular emphasis on their roles in the skin during inflammation and carcinogenesis.

        In the context of skin cancers, what dual role can the CXCR3 receptor play, and how does its expression on different cell types contribute to cancer outcomes? 01/14/2018

        In skin cancers, the CXCR3 receptor can play a dual role. Its expression on tumor cells can lead to cancer metastasis, while expression on immune cells can promote anti-tumor immune responses.

        What drives the expression of CXCL9, CXCL10, and CXCL11, and what is their function in recruiting CXCR3+ T cells during skin inflammation? 11/27/2016

        The expression of CXCL9, CXCL10, and CXCL11 is driven by inflammation of the skin resulting from infections or autoimmune disease, leading to the recruitment of effector, CXCR3+ T cells from the circulation.

        Ask a Question for All CXCR3 Products

        Required fields are marked with *

        My Review for All CXCR3 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /
        • Service lnquiry:

        Stay Updated on the Latest Bioscience Trends