Recombinant Human DDB2 Protein, His-tagged

Cat.No. : DDB2-28309TH
Product Overview : Recombinant Human DDB2(1-261 aa) fused with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-261 aa
Description : This gene encodes a protein that is necessary for the repair of ultraviolet light-damaged DNA. This protein is the smaller subunit of a heterodimeric protein complex that participates in nucleotide excision repair, and this complex mediates the ubiquitylation of histones H3 and H4, which facilitates the cellular response to DNA damage. This subunit appears to be required for DNA binding. Mutations in this gene cause xeroderma pigmentosum complementation group E, a recessive disease that is characterized by an increased sensitivity to UV light and a high predisposition for skin cancer development, in some cases accompanied by neurological abnormalities. Two transcript variants encoding different isoforms have been found for this gene.
Form : Preservative: None
Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
AA Sequence : MAPKKRPETQKTSEIVLRPRNKRSRSPLELEPEAKKLCAKGSGPSRRCDSDCLWVGLAGPQILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWHPTHPSTVAVGSKGGDIMLWNFGIKDKPTFI KGIGAGGSITGLKFNPLNTNQFYASSMEGTTRLQDFKGNILRVFASSDTI NIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKELWNLRMHKKKVTHVAL NPCCDWFLATA
Applications : SDS-PAGE
Mass Spectrometry
Storage : Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Reconstitution : Reconstitute with 59 µl aqua dest.
Gene Name DDB2 damage-specific DNA binding protein 2, 48kDa [ Homo sapiens ]
Official Symbol DDB2
Synonyms DDB2; damage-specific DNA binding protein 2, 48kDa; damage specific DNA binding protein 2 (48kD); DNA damage-binding protein 2; DDB p48 subunit; DDBB; FLJ34321; UV damaged DNA binding protein 2; UV DDB2; xeroderma pigmentosum group E protein; UV-DDB 2; UV-damaged DNA-binding protein 2; damage-specific DNA-binding protein 2; UV-DDB2;
Gene ID 1643
mRNA Refseq NM_000107
Protein Refseq NP_000098
MIM 600811
UniProt ID Q92466

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DDB2 Products

Required fields are marked with *

My Review for All DDB2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon