Recombinant Human DDB2 Protein, His-tagged
Cat.No. : | DDB2-28309TH |
Product Overview : | Recombinant Human DDB2(1-261 aa) fused with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-261 aa |
Description : | This gene encodes a protein that is necessary for the repair of ultraviolet light-damaged DNA. This protein is the smaller subunit of a heterodimeric protein complex that participates in nucleotide excision repair, and this complex mediates the ubiquitylation of histones H3 and H4, which facilitates the cellular response to DNA damage. This subunit appears to be required for DNA binding. Mutations in this gene cause xeroderma pigmentosum complementation group E, a recessive disease that is characterized by an increased sensitivity to UV light and a high predisposition for skin cancer development, in some cases accompanied by neurological abnormalities. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | Preservative: None Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
AA Sequence : | MAPKKRPETQKTSEIVLRPRNKRSRSPLELEPEAKKLCAKGSGPSRRCDSDCLWVGLAGPQILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWHPTHPSTVAVGSKGGDIMLWNFGIKDKPTFI KGIGAGGSITGLKFNPLNTNQFYASSMEGTTRLQDFKGNILRVFASSDTI NIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKELWNLRMHKKKVTHVAL NPCCDWFLATA |
Applications : | SDS-PAGE Mass Spectrometry |
Storage : | Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Reconstitution : | Reconstitute with 59 µl aqua dest. |
Gene Name | DDB2 damage-specific DNA binding protein 2, 48kDa [ Homo sapiens ] |
Official Symbol | DDB2 |
Synonyms | DDB2; damage-specific DNA binding protein 2, 48kDa; damage specific DNA binding protein 2 (48kD); DNA damage-binding protein 2; DDB p48 subunit; DDBB; FLJ34321; UV damaged DNA binding protein 2; UV DDB2; xeroderma pigmentosum group E protein; UV-DDB 2; UV-damaged DNA-binding protein 2; damage-specific DNA-binding protein 2; UV-DDB2; |
Gene ID | 1643 |
mRNA Refseq | NM_000107 |
Protein Refseq | NP_000098 |
MIM | 600811 |
UniProt ID | Q92466 |
◆ Recombinant Proteins | ||
DDB2-05TH | Recombinant Human DDB2 Protein, GST-tagged | +Inquiry |
Ddb2-453H | Recombinant Mouse Ddb2 Protein, His-tagged | +Inquiry |
DDB2-057H | Recombinant Human DDB2 Protein, GST-tagged | +Inquiry |
DDB2-1204R | Recombinant Rhesus monkey DDB2 Protein, His-tagged | +Inquiry |
DDB2-1029R | Recombinant Rhesus Macaque DDB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDB2-7029HCL | Recombinant Human DDB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDB2 Products
Required fields are marked with *
My Review for All DDB2 Products
Required fields are marked with *
0
Inquiry Basket