Recombinant Human DDIT3 protein, His-tagged
| Cat.No. : | DDIT3-3923H |
| Product Overview : | Recombinant Human DDIT3 protein(1-169 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 27, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-169 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | DDIT3 DNA-damage-inducible transcript 3 [ Homo sapiens ] |
| Official Symbol | DDIT3 |
| Synonyms | DDIT3; DNA-damage-inducible transcript 3; DNA damage-inducible transcript 3 protein; C/EBP zeta; CHOP; CHOP10; GADD153; DDIT-3; c/EBP-homologous protein 10; CCAAT/enhancer-binding protein homologous protein; growth arrest and DNA damage-inducible protein GADD153; CEBPZ; CHOP-10; MGC4154; |
| Gene ID | 1649 |
| mRNA Refseq | NM_001195053 |
| Protein Refseq | NP_001181982 |
| MIM | 126337 |
| UniProt ID | P35638 |
| ◆ Recombinant Proteins | ||
| DDIT3-3639H | Recombinant Human DDIT3 protein, GST-tagged | +Inquiry |
| DDIT3-859H | Recombinant Human DDIT3 Protein, GST-His-tagged | +Inquiry |
| DDIT3-3640H | Recombinant Human DDIT3 protein, His-tagged | +Inquiry |
| DDIT3-126H | Recombinant Human DDIT3 protein, T7/His-tagged | +Inquiry |
| DDIT3-2442H | Recombinant Human DDIT3 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DDIT3-7027HCL | Recombinant Human DDIT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDIT3 Products
Required fields are marked with *
My Review for All DDIT3 Products
Required fields are marked with *
