Recombinant Human DDIT3 protein, His-tagged
Cat.No. : | DDIT3-3923H |
Product Overview : | Recombinant Human DDIT3 protein(1-169 aa), fused to His tag, was expressed in E. coli. |
Availability | July 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-169 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | DDIT3 DNA-damage-inducible transcript 3 [ Homo sapiens ] |
Official Symbol | DDIT3 |
Synonyms | DDIT3; DNA-damage-inducible transcript 3; DNA damage-inducible transcript 3 protein; C/EBP zeta; CHOP; CHOP10; GADD153; DDIT-3; c/EBP-homologous protein 10; CCAAT/enhancer-binding protein homologous protein; growth arrest and DNA damage-inducible protein GADD153; CEBPZ; CHOP-10; MGC4154; |
Gene ID | 1649 |
mRNA Refseq | NM_001195053 |
Protein Refseq | NP_001181982 |
MIM | 126337 |
UniProt ID | P35638 |
◆ Recombinant Proteins | ||
DDIT3-130H | Recombinant Human DNA-damage-inducible Transcript 3 | +Inquiry |
DDIT3-3639H | Recombinant Human DDIT3 protein, GST-tagged | +Inquiry |
DDIT3-4948H | Recombinant Human DNA-Damage-Inducible Transcript 3, His-tagged | +Inquiry |
DDIT3-3923H | Recombinant Human DDIT3 protein, His-tagged | +Inquiry |
DDIT3-4387M | Recombinant Mouse DDIT3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDIT3-7027HCL | Recombinant Human DDIT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDIT3 Products
Required fields are marked with *
My Review for All DDIT3 Products
Required fields are marked with *