Recombinant Human DDIT3 protein, T7/His-tagged

Cat.No. : DDIT3-126H
Product Overview : Recombinant human DDIT3 cDNA (169 aa, isoform 2) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEE ESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKE KEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro stress mediated DNA damage pathway regulation study with intracellular delivery of recombinant DDIT3 protein technology, such as PULSinTM protein transfaction system.2. May be used as specific substate protein for kinase or ubiquitin ligase assay development.3. May be used as antigen for specific antibody production.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name DDIT3 DNA-damage-inducible transcript 3 [ Homo sapiens ]
Official Symbol DDIT3
Synonyms DDIT3; DNA-damage-inducible transcript 3; DNA damage-inducible transcript 3 protein; C/EBP zeta; CHOP; CHOP10; GADD153; DDIT-3; CEBPZ; CHOP-10; MGC4154;
Gene ID 1649
mRNA Refseq NM_001195053
Protein Refseq NP_001181982
MIM 126337
UniProt ID P35638
Chromosome Location 12q13.1-q13.2
Pathway ATF-2 transcription factor network, organism-specific biosystem; Activation of Chaperone Genes by ATF6-alpha, organism-specific biosystem; Activation of Chaperones by ATF6-alpha, organism-specific biosystem; Activation of Genes by ATF4, organism-specific biosystem; Adipogenesis, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem;
Function DNA binding; protein dimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription corepressor activity; transcription factor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DDIT3 Products

Required fields are marked with *

My Review for All DDIT3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon