Recombinant Human DDIT3 protein, T7/His-tagged
Cat.No. : | DDIT3-126H |
Product Overview : | Recombinant human DDIT3 cDNA (169 aa, isoform 2) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEE ESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKE KEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro stress mediated DNA damage pathway regulation study with intracellular delivery of recombinant DDIT3 protein technology, such as PULSinTM protein transfaction system.2. May be used as specific substate protein for kinase or ubiquitin ligase assay development.3. May be used as antigen for specific antibody production. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | DDIT3 DNA-damage-inducible transcript 3 [ Homo sapiens ] |
Official Symbol | DDIT3 |
Synonyms | DDIT3; DNA-damage-inducible transcript 3; DNA damage-inducible transcript 3 protein; C/EBP zeta; CHOP; CHOP10; GADD153; DDIT-3; CEBPZ; CHOP-10; MGC4154; |
Gene ID | 1649 |
mRNA Refseq | NM_001195053 |
Protein Refseq | NP_001181982 |
MIM | 126337 |
UniProt ID | P35638 |
Chromosome Location | 12q13.1-q13.2 |
Pathway | ATF-2 transcription factor network, organism-specific biosystem; Activation of Chaperone Genes by ATF6-alpha, organism-specific biosystem; Activation of Chaperones by ATF6-alpha, organism-specific biosystem; Activation of Genes by ATF4, organism-specific biosystem; Adipogenesis, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; |
Function | DNA binding; protein dimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription corepressor activity; transcription factor binding; |
◆ Recombinant Proteins | ||
DDIT3-2255M | Recombinant Mouse DDIT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
DDIT3-1935H | Recombinant Human DDIT3 Protein (Met1-Ala169), N-His tagged | +Inquiry |
DDIT3-5226Z | Recombinant Zebrafish DDIT3 | +Inquiry |
DDIT3-1031R | Recombinant Rhesus Macaque DDIT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
DDIT3-26512TH | Recombinant Human DDIT3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDIT3-7027HCL | Recombinant Human DDIT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDIT3 Products
Required fields are marked with *
My Review for All DDIT3 Products
Required fields are marked with *