Recombinant Human DNMT3B protein, GST-tagged
| Cat.No. : | DNMT3B-3712H |
| Product Overview : | Recombinant Human DNMT3B protein(1-100 aa), fused to GST tag, was expressed in E. coli. |
| Availability | September 29, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-100 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDLTGDGDGEDGDGSDTPVMPKLFRETRTRSES |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | DNMT3B DNA (cytosine-5-)-methyltransferase 3 beta [ Homo sapiens ] |
| Official Symbol | DNMT3B |
| Synonyms | DNMT3B; DNA (cytosine-5-)-methyltransferase 3 beta; DNA (cytosine-5)-methyltransferase 3B; DNA MTase HsaIIIB; DNA methyltransferase HsaIIIB; ICF; ICF1; M.HsaIIIB; |
| Gene ID | 1789 |
| mRNA Refseq | NM_001207055 |
| Protein Refseq | NP_001193984 |
| MIM | 602900 |
| UniProt ID | Q9UBC3 |
| ◆ Recombinant Proteins | ||
| DNMT3B-74H | Recombinant Human DNMT3B protein, GST-tagged | +Inquiry |
| DNMT3B-165H | Active Recombinant Human DNMT3B, GST-tagged | +Inquiry |
| DNMT3B-3712H | Recombinant Human DNMT3B protein, GST-tagged | +Inquiry |
| DNMT3B-166H | Active Recombinant Full Length Human DNMT3B Protein, N-6xHis-tagged | +Inquiry |
| DNMT3B-780H | Recombinant Human DNMT3B Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DNMT3B-6854HCL | Recombinant Human DNMT3B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNMT3B Products
Required fields are marked with *
My Review for All DNMT3B Products
Required fields are marked with *
