Recombinant Human DNMT3B protein, GST-tagged

Cat.No. : DNMT3B-3712H
Product Overview : Recombinant Human DNMT3B protein(1-100 aa), fused to GST tag, was expressed in E. coli.
Availability July 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-100 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDLTGDGDGEDGDGSDTPVMPKLFRETRTRSES
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name DNMT3B DNA (cytosine-5-)-methyltransferase 3 beta [ Homo sapiens ]
Official Symbol DNMT3B
Synonyms DNMT3B; DNA (cytosine-5-)-methyltransferase 3 beta; DNA (cytosine-5)-methyltransferase 3B; DNA MTase HsaIIIB; DNA methyltransferase HsaIIIB; ICF; ICF1; M.HsaIIIB;
Gene ID 1789
mRNA Refseq NM_001207055
Protein Refseq NP_001193984
MIM 602900
UniProt ID Q9UBC3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DNMT3B Products

Required fields are marked with *

My Review for All DNMT3B Products

Required fields are marked with *

0
cart-icon