Recombinant Human EFHD2 Protein, GST-tagged
| Cat.No. : | EFHD2-3095H |
| Product Overview : | Human EFHD2 full-length ORF ( NP_077305.2, 1 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | EFHD2 (EF-Hand Domain Family Member D2) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is EFHD1. |
| Molecular Mass : | 53.1 kDa |
| AA Sequence : | MATDELATKLSRRLQMEGEGGGETPEQPGLNGAAAAAAGAPDEAAEALGSADCELSAKLLRRADLNQGIGEPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLCVLARLSEIDVSSEGVKGAKSFFEAKVQAINVSSRFEEEIKAEQEERKKQAEEMKQRKAAFKELQSTFK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EFHD2 EF-hand domain family, member D2 [ Homo sapiens ] |
| Official Symbol | EFHD2 |
| Synonyms | EFHD2; EF-hand domain family, member D2; SWS1; RP3-467K16.3 |
| Gene ID | 79180 |
| mRNA Refseq | NM_024329 |
| Protein Refseq | NP_077305 |
| MIM | 616450 |
| UniProt ID | Q96C19 |
| ◆ Recombinant Proteins | ||
| EFHD2-5430H | Recombinant Human EFHD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| EFHD2-1384H | Recombinant Human EFHD2 Protein, MYC/DDK-tagged | +Inquiry |
| EFHD2-4214HF | Recombinant Full Length Human EFHD2 Protein, GST-tagged | +Inquiry |
| EFHD2-4232Z | Recombinant Zebrafish EFHD2 | +Inquiry |
| EFHD2-2142M | Recombinant Mouse EFHD2 Protein (2-240 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EFHD2 Products
Required fields are marked with *
My Review for All EFHD2 Products
Required fields are marked with *
