Recombinant Human EFHD2 Protein, GST-tagged

Cat.No. : EFHD2-3095H
Product Overview : Human EFHD2 full-length ORF ( NP_077305.2, 1 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : EFHD2 (EF-Hand Domain Family Member D2) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is EFHD1.
Molecular Mass : 53.1 kDa
AA Sequence : MATDELATKLSRRLQMEGEGGGETPEQPGLNGAAAAAAGAPDEAAEALGSADCELSAKLLRRADLNQGIGEPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLCVLARLSEIDVSSEGVKGAKSFFEAKVQAINVSSRFEEEIKAEQEERKKQAEEMKQRKAAFKELQSTFK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EFHD2 EF-hand domain family, member D2 [ Homo sapiens ]
Official Symbol EFHD2
Synonyms EFHD2; EF-hand domain family, member D2; SWS1; RP3-467K16.3
Gene ID 79180
mRNA Refseq NM_024329
Protein Refseq NP_077305
MIM 616450
UniProt ID Q96C19

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EFHD2 Products

Required fields are marked with *

My Review for All EFHD2 Products

Required fields are marked with *

0
cart-icon