Recombinant Human EFHD2 Protein, GST-tagged
Cat.No. : | EFHD2-3095H |
Product Overview : | Human EFHD2 full-length ORF ( NP_077305.2, 1 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | EFHD2 (EF-Hand Domain Family Member D2) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is EFHD1. |
Molecular Mass : | 53.1 kDa |
AA Sequence : | MATDELATKLSRRLQMEGEGGGETPEQPGLNGAAAAAAGAPDEAAEALGSADCELSAKLLRRADLNQGIGEPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLCVLARLSEIDVSSEGVKGAKSFFEAKVQAINVSSRFEEEIKAEQEERKKQAEEMKQRKAAFKELQSTFK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EFHD2 EF-hand domain family, member D2 [ Homo sapiens ] |
Official Symbol | EFHD2 |
Synonyms | EFHD2; EF-hand domain family, member D2; SWS1; RP3-467K16.3 |
Gene ID | 79180 |
mRNA Refseq | NM_024329 |
Protein Refseq | NP_077305 |
MIM | 616450 |
UniProt ID | Q96C19 |
◆ Recombinant Proteins | ||
EFHD2-2023R | Recombinant Rat EFHD2 Protein | +Inquiry |
EFHD2-1680R | Recombinant Rat EFHD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Efhd2-2752M | Recombinant Mouse Efhd2 Protein, Myc/DDK-tagged | +Inquiry |
EFHD2-1391R | Recombinant Rhesus monkey EFHD2 Protein, His-tagged | +Inquiry |
EFHD2-1384H | Recombinant Human EFHD2 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EFHD2 Products
Required fields are marked with *
My Review for All EFHD2 Products
Required fields are marked with *
0
Inquiry Basket