Recombinant Human EGF Protein, GMP Grade, Animal-Free

Cat.No. : EGF-27HG
Product Overview : GMP Recombinant Human EGF protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : EGF is a potent growth factor that stimulates the proliferation of various epidermal and epithelial cells. Additionally, EGF has been shown to inhibit gastric secretion, and to be involved in wound healing. EGF signals through a receptor known as c-erbB, which is a class I tyrosine kinase receptor. This receptor also binds with TGF-α and VGF (vaccinia virus growth factor).
AA Sequence : NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Purity : ≥ 98% by SDS-PAGE gel and HPLC analyses.
Gene Name EGF epidermal growth factor [ Homo sapiens (human) ]
Official Symbol EGF
Synonyms EGF; epidermal growth factor; epidermal growth factor (beta urogastrone); pro-epidermal growth factor; beta-urogastrone; URG; HOMG4;
Gene ID 1950
mRNA Refseq NM_001178130
Protein Refseq NP_001171601
MIM 131530
UniProt ID P01133

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EGF Products

Required fields are marked with *

My Review for All EGF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon