Recombinant Human EGFR protein, His-tagged

Cat.No. : EGFR-628H
Product Overview : Recombinant Human EGFR Protein (25-378aa), was expressed in HEK293 with C-terminal His tag.
  • Specification
  • Gene Information
  • Related Products
  • Citation
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 25-378 aa
Form : Lyophilized from a 0.2 μM filtered solution of PBS,pH 7.4
AA Sequence : LEEKKGNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNI KHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFE NLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQ KTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVE NSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHV CHLCHPNCTYGCTGPGLEGCPTNGPKIPSVDHHHHHH
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg).
Purity : Greater than 95% as determined SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 4 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping : The product is shipped at ambient temperature.
Gene Name EGFR epidermal growth factor receptor [ Homo sapiens ]
Official Symbol EGFR
Synonyms EGFR; epidermal growth factor receptor; epidermal growth factor receptor (avian erythroblastic leukemia viral (v erb b) oncogene homolog) , ERBB; ERBB1; erythroblastic leukemia viral (v erb b) oncogene homolog (avian); proto-oncogene c-ErbB-1; cell growth inhibiting protein 40; cell proliferation-inducing protein 61; receptor tyrosine-protein kinase erbB-1; avian erythroblastic leukemia viral (v-erb-b) oncogene homolog; ERBB; HER1; mENA; PIG61;
Gene ID 1956
mRNA Refseq NM_201283
Protein Refseq NP_958440
MIM 131550
UniProt ID P00533
Chromosome Location 7p12
Pathway Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Arf6 signaling events, organism-specific biosystem; Axon guidance, organism-specific biosystem; Bladder cancer, organism-specific biosystem;
Function ATP binding; MAPK/ERK kinase kinase activity; actin filament binding; double-stranded DNA binding; enzyme binding; epidermal growth factor-activated receptor activity; epidermal growth factor-activated receptor activity; identical protein binding; contributes_to nitric-oxide synthase regulator activity; nucleotide binding; protein binding; protein heterodimerization activity; protein phosphatase binding; protein tyrosine kinase activity; protein tyrosine kinase activity; protein tyrosine kinase activity; receptor activity; receptor signaling protein tyrosine kinase activity; signal transducer activity; transmembrane receptor protein tyrosine kinase activity; transmembrane receptor protein tyrosine kinase activity; transmembrane signaling receptor activity;

Regulation of EGFR Protein Stability by the HECT-type Ubiquitin Ligase SMURF2

Journal: Neoplasia (New York, N.Y.)    PubMed ID: 21750651    Data: 2011/7/1

Authors: Dipankar Ray, Aarif Ahsan, Mukesh K Nyati

Article Snippet:GST-SMURF2 was purified from bacteria as previously described [ 30 ], and 1 μg of fusion protein still attached to agarose beads was equilibrated in 0.5x Superdex buffer (1x Superdex buffer: 25 mM HEPES, pH 7.5, 12.5 mM MgCl 2 , 10 μM ZnSO 4 , 150 mM KCl, 20% glycerol, 0.1% Nonidet P-40, and 1 mM EDTA) for 30 minutes at 4°C and then washed three times with 0.5x Superdex buffer.agarose beads was equilibrated in 0.5x Superdex buffer (1x Superdex buffer: 25 mM HEPES, pH 7.5, 12.5 mM MgCl 2 , 10 μM ZnSO 4 , 150 mM KCl, 20% glycerol, 0.1% Nonidet P-40, and 1 mM EDTA) for 30 minutes at 4°C and then washed three times with 0.5x Superdex buffer. ... Beads were then incubated with either about 200 or 600 ng of purified His-tagged EGFR protein (Creative BioMart, New York, NY) was then added to the washed beads and incubated overnight at 4°C.. The beads were washed three times using 0.5 Superdex buffer and boiled in Laemmli buffer, and the bound SMURF2-EGFR complex was immunodetected after immunoblot analysis with SMURF2 and Tetra-His (for EGFR) antibodies.The beads were washed three times using 0.5 Superdex buffer and boiled in Laemmli buffer, and the bound SMURF2-EGFR complex was immunodetected after immunoblot analysis with SMURF2 and Tetra-His (for EGFR) antibodies.

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EGFR Products

Required fields are marked with *

My Review for All EGFR Products

Required fields are marked with *

0
cart-icon
0
compare icon