Recombinant Human EGFR protein, His-tagged
Cat.No. : | EGFR-628H |
Product Overview : | Recombinant Human EGFR(Leu25-Ser378) fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Citation
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | Leu25-Ser378 |
Form : | Lyophilized from a 0.2 μM filtered solution of PBS,pH 7.4 |
AA Sequence : | LEEKKGNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNI KHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFE NLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQ KTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVE NSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHV CHLCHPNCTYGCTGPGLEGCPTNGPKIPSVDHHHHHH |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg). |
Purity : | Greater than 95% as determined SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 4 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Shipping : | The product is shipped at ambient temperature. |
Gene Name | EGFR epidermal growth factor receptor [ Homo sapiens ] |
Official Symbol | EGFR |
Synonyms | EGFR; epidermal growth factor receptor; epidermal growth factor receptor (avian erythroblastic leukemia viral (v erb b) oncogene homolog) , ERBB; ERBB1; erythroblastic leukemia viral (v erb b) oncogene homolog (avian); proto-oncogene c-ErbB-1; cell growth inhibiting protein 40; cell proliferation-inducing protein 61; receptor tyrosine-protein kinase erbB-1; avian erythroblastic leukemia viral (v-erb-b) oncogene homolog; ERBB; HER1; mENA; PIG61; |
Gene ID | 1956 |
mRNA Refseq | NM_201283 |
Protein Refseq | NP_958440 |
MIM | 131550 |
UniProt ID | P00533 |
Chromosome Location | 7p12 |
Pathway | Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Arf6 signaling events, organism-specific biosystem; Axon guidance, organism-specific biosystem; Bladder cancer, organism-specific biosystem; |
Function | ATP binding; MAPK/ERK kinase kinase activity; actin filament binding; double-stranded DNA binding; enzyme binding; epidermal growth factor-activated receptor activity; epidermal growth factor-activated receptor activity; identical protein binding; contributes_to nitric-oxide synthase regulator activity; nucleotide binding; protein binding; protein heterodimerization activity; protein phosphatase binding; protein tyrosine kinase activity; protein tyrosine kinase activity; protein tyrosine kinase activity; receptor activity; receptor signaling protein tyrosine kinase activity; signal transducer activity; transmembrane receptor protein tyrosine kinase activity; transmembrane receptor protein tyrosine kinase activity; transmembrane signaling receptor activity; |
◆ Recombinant Proteins | ||
EGFR-1226RA | Recombinant Rhesus EGFR protein, Fc-tagged, APC labeled | +Inquiry |
Egfr-7630M | Recombinant Mouse Egfr protein, His & T7-tagged | +Inquiry |
EGFR-692HP | Recombinant Human EGFR protein, Fc-tagged, R-PE labeled | +Inquiry |
EGFR-211H | Recombinant Human EGFR Protein, His-tagged | +Inquiry |
EGFR-024HP | Recombinant Human EGFR protein, Fc-tagged, R-PE labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGFR-663HCL | Recombinant Human EGFR cell lysate | +Inquiry |
EGFR-1462RCL | Recombinant Rat EGFR cell lysate | +Inquiry |
EGFR-2733HCL | Recombinant Human EGFR cell lysate | +Inquiry |
EGFR-1621MCL | Recombinant Mouse EGFR cell lysate | +Inquiry |
Regulation of EGFR Protein Stability by the HECT-type Ubiquitin Ligase SMURF2
Journal: Neoplasia (New York, N.Y.) PubMed ID: 21750651 Data: 2011/7/1
Authors: Dipankar Ray, Aarif Ahsan, Mukesh K Nyati
Article Snippet:GST-SMURF2 was purified from bacteria as previously described [ 30 ], and 1 μg of fusion protein still attached to agarose beads was equilibrated in 0.5x Superdex buffer (1x Superdex buffer: 25 mM HEPES, pH 7.5, 12.5 mM MgCl 2 , 10 μM ZnSO 4 , 150 mM KCl, 20% glycerol, 0.1% Nonidet P-40, and 1 mM EDTA) for 30 minutes at 4°C and then washed three times with 0.5x Superdex buffer.agarose beads was equilibrated in 0.5x Superdex buffer (1x Superdex buffer: 25 mM HEPES, pH 7.5, 12.5 mM MgCl 2 , 10 μM ZnSO 4 , 150 mM KCl, 20% glycerol, 0.1% Nonidet P-40, and 1 mM EDTA) for 30 minutes at 4°C and then washed three times with 0.5x Superdex buffer. ... Beads were then incubated with either about 200 or 600 ng of purified His-tagged EGFR protein (Creative BioMart, New York, NY) was then added to the washed beads and incubated overnight at 4°C.. The beads were washed three times using 0.5 Superdex buffer and boiled in Laemmli buffer, and the bound SMURF2-EGFR complex was immunodetected after immunoblot analysis with SMURF2 and Tetra-His (for EGFR) antibodies.The beads were washed three times using 0.5 Superdex buffer and boiled in Laemmli buffer, and the bound SMURF2-EGFR complex was immunodetected after immunoblot analysis with SMURF2 and Tetra-His (for EGFR) antibodies.
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGFR Products
Required fields are marked with *
My Review for All EGFR Products
Required fields are marked with *