Recombinant Human EIF4E2 protein, T7-tagged

Cat.No. : EIF4E2-154H
Product Overview : Recombinant human EIF4E2 (245 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 245 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGEFMNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNY TFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKW IIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNT IMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP
Purity : >90% by SDS-PAGE
Applications : 1. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.2. May be used for mapping EIF4E2 protein-protein interaction.3. May be used as antigen for specific antibody production.
Storage : Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name EIF4E2 eukaryotic translation initiation factor 4E family member 2 [ Homo sapiens ]
Official Symbol EIF4E2
Synonyms EIF4E2; 4EHP; IF4e; eIF4E type 2; eIF-4E type 2; eIF4E-like protein 4E-LP; mRNA cap-binding protein 4EHP; eIF4E-like cap-binding protein; mRNA cap-binding protein type 3; 4E-LP; EIF4EL3;
Gene ID 9470
mRNA Refseq NM_004846
Protein Refseq NP_004837
MIM 605895
UniProt ID O60573
Chromosome Location 2q37.1
Pathway Antiviral mechanism by IFN-stimulated genes, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; ISG15 antiviral mechanism, organism-specific biosystem; Immune System, organism-specific biosystem; Insulin signaling pathway, organism-specific biosystem; Insulin signaling pathway, conserved biosystem; Interferon Signaling, organism-specific biosystem;
Function RNA cap binding; protein binding; translation factor activity, nucleic acid binding; translation initiation factor activity; ubiquitin protein ligase binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF4E2 Products

Required fields are marked with *

My Review for All EIF4E2 Products

Required fields are marked with *

0
cart-icon