"EIF4E2" Related Products

Expand

Recombinant Human EIF4E2 protein, T7-tagged

Cat.No.: EIF4E2-154H
Product Overview: Recombinant human EIF4E2 (245 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGEFMNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNY TFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKW IIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNT IMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP
Purity: >90% by SDS-PAGE
Applications: 1. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.2. May be used for mapping EIF4E2 protein-protein interaction.3. May be used as antigen for specific antibody production.
Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: EIF4E2 eukaryotic translation initiation factor 4E family member 2 [ Homo sapiens ]
Official Symbol: EIF4E2
Synonyms: EIF4E2; 4EHP; IF4e; eIF4E type 2; eIF-4E type 2; eIF4E-like protein 4E-LP; mRNA cap-binding protein 4EHP; eIF4E-like cap-binding protein; mRNA cap-binding protein type 3; 4E-LP; EIF4EL3;
Gene ID: 9470
mRNA Refseq: NM_004846
Protein Refseq: NP_004837
MIM: 605895
UniProt ID: O60573
Chromosome Location: 2q37.1
Pathway: Antiviral mechanism by IFN-stimulated genes, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; ISG15 antiviral mechanism, organism-specific biosystem; Immune System, organism-specific biosystem; Insulin signaling pathway, organism-specific biosystem; Insulin signaling pathway, conserved biosystem; Interferon Signaling, organism-specific biosystem;
Function: RNA cap binding; protein binding; translation factor activity, nucleic acid binding; translation initiation factor activity; ubiquitin protein ligase binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.