Recombinant Human EIF4E2 protein, T7-tagged
Cat.No. : | EIF4E2-154H |
Product Overview : | Recombinant human EIF4E2 (245 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 245 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGEFMNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNY TFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKW IIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNT IMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP |
Purity : | >90% by SDS-PAGE |
Applications : | 1. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.2. May be used for mapping EIF4E2 protein-protein interaction.3. May be used as antigen for specific antibody production. |
Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | EIF4E2 eukaryotic translation initiation factor 4E family member 2 [ Homo sapiens ] |
Official Symbol | EIF4E2 |
Synonyms | EIF4E2; 4EHP; IF4e; eIF4E type 2; eIF-4E type 2; eIF4E-like protein 4E-LP; mRNA cap-binding protein 4EHP; eIF4E-like cap-binding protein; mRNA cap-binding protein type 3; 4E-LP; EIF4EL3; |
Gene ID | 9470 |
mRNA Refseq | NM_004846 |
Protein Refseq | NP_004837 |
MIM | 605895 |
UniProt ID | O60573 |
Chromosome Location | 2q37.1 |
Pathway | Antiviral mechanism by IFN-stimulated genes, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; ISG15 antiviral mechanism, organism-specific biosystem; Immune System, organism-specific biosystem; Insulin signaling pathway, organism-specific biosystem; Insulin signaling pathway, conserved biosystem; Interferon Signaling, organism-specific biosystem; |
Function | RNA cap binding; protein binding; translation factor activity, nucleic acid binding; translation initiation factor activity; ubiquitin protein ligase binding; |
◆ Recombinant Proteins | ||
EIF4E2-829H | Recombinant Human EIF4E2 Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF4E2-28495TH | Recombinant Human EIF4E2, T7 -tagged | +Inquiry |
Eif4e2-2787M | Recombinant Mouse Eif4e2 Protein, Myc/DDK-tagged | +Inquiry |
EIF4E2-12379H | Recombinant Human EIF4E2, GST-tagged | +Inquiry |
EIF4E2-2160H | Recombinant Human EIF4E2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF4E2-6650HCL | Recombinant Human EIF4E2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EIF4E2 Products
Required fields are marked with *
My Review for All EIF4E2 Products
Required fields are marked with *
0
Inquiry Basket