Recombinant Human EIF5 Protein (1-431 aa), His-SUMO-tagged
Cat.No. : | EIF5-478H |
Product Overview : | Recombinant Human EIF5 Protein (1-431 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-431 aa |
Description : | Catalyzes the hydrolysis of GTP bound to the 40S ribosomal initiation complex (40S.mRNA.Met-tRNA[F].eIF-2.GTP) with the subsequent joining of a 60S ribosomal subunit resulting in the release of eIF-2 and the guanine nucleotide. The subsequent joining of a 60S ribosomal subunit results in the formation of a functional 80S initiation complex (80S.mRNA.Met-tRNA[F]). |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 65.2 kDa |
AA Sequence : | MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEEAQRRRMDEISDHAKVLTLSDDLERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVLTEVLFNEKIREQIKKYRRHFLRFCHNNKKAQRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEVIISWSEKASKKYVSKELAKEIRVKAEPFIKWLKEAEEESSGGEEEDEDENIEVVYSKAASVPKVETVKSDNKDDDIDIDAI |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | EIF5 eukaryotic translation initiation factor 5 [ Homo sapiens ] |
Official Symbol | EIF5 |
Synonyms | EIF5; eIF-5; EIF-5A; |
Gene ID | 1983 |
mRNA Refseq | NM_001969 |
Protein Refseq | NP_001960 |
MIM | 601710 |
UniProt ID | P55010 |
◆ Recombinant Proteins | ||
Eif5-2791M | Recombinant Mouse Eif5 Protein, Myc/DDK-tagged | +Inquiry |
EIF5-1726R | Recombinant Rat EIF5 Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF5-3395H | Recombinant Human EIF5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EIF5-27177TH | Recombinant Human EIF5 protein, GST-tagged | +Inquiry |
EIF5-1627C | Recombinant Chicken EIF5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF5-6642HCL | Recombinant Human EIF5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF5 Products
Required fields are marked with *
My Review for All EIF5 Products
Required fields are marked with *
0
Inquiry Basket