Recombinant Human ELK1 protein, His-tagged
| Cat.No. : | ELK1-6734H |
| Product Overview : | Recombinant Human ELK1 protein(161-320 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 161-320 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | TFTIQSLQPQPPPHPRPAVVLPSAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGLGRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGHAASSPEISQPQKGRKPRDLE |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | ELK1 ELK1, member of ETS oncogene family [ Homo sapiens ] |
| Official Symbol | ELK1 |
| Synonyms | ELK1; ELK1, member of ETS oncogene family; ETS domain-containing protein Elk-1; ETS-like gene 1; tyrosine kinase (ELK1) oncogene; |
| Gene ID | 2002 |
| mRNA Refseq | NM_001114123 |
| Protein Refseq | NP_001107595 |
| MIM | 311040 |
| UniProt ID | P19419 |
| ◆ Recombinant Proteins | ||
| ELK1-5134M | Recombinant Mouse ELK1 Protein | +Inquiry |
| ELK1-3243H | Recombinant Human ELK1 Protein, GST-tagged | +Inquiry |
| ELK1-235C | Recombinant Cynomolgus Monkey ELK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ELK1-4841H | Recombinant Human ELK1, Member Of ETS Oncogene Family, GST-tagged | +Inquiry |
| ELK1-6734H | Recombinant Human ELK1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ELK1-520HCL | Recombinant Human ELK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELK1 Products
Required fields are marked with *
My Review for All ELK1 Products
Required fields are marked with *
