Recombinant Human ENAM protein, GST-tagged

Cat.No. : ENAM-43H
Product Overview : Recombinant Human ENAM(1043 a.a. - 1141 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1043-1141 a.a.
Description : Dental enamel forms the outer cap of teeth and is the hardest substance found in vertebrates. This gene encodes the largest protein in the enamel matrix of developing teeth. The protein is involved in the mineralization and structural organization of enamel. Defects in this gene result in amelogenesis imperfect type 1C.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.63 kDa
AA Sequence : ERQQQRPSNILHLPCFGSKLAKHHSSTTGTPSSDGRQSPFDGDSITPTENPNTLVELATEEQFKSINVDPLDADEHSPFEFLQRGTNVQDQVQDCLLLQ
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name ENAM enamelin [ Homo sapiens ]
Official Symbol ENAM
Synonyms ENAM; enamelin; AIH2, amelogenesis imperfecta 2, hypocalcification (autosomal dominant); amelogenesis imperfecta 2, hypocalcification (autosomal dominant); ADAI; AI1C; AIH2;
Gene ID 10117
mRNA Refseq NM_031889
Protein Refseq NP_114095
MIM 606585
UniProt ID Q9NRM1
Chromosome Location 4q13.3
Function structural constituent of tooth enamel;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ENAM Products

Required fields are marked with *

My Review for All ENAM Products

Required fields are marked with *

0
cart-icon