Recombinant Human ENAM protein, GST-tagged
Cat.No. : | ENAM-43H |
Product Overview : | Recombinant Human ENAM(1043 a.a. - 1141 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1043-1141 a.a. |
Description : | Dental enamel forms the outer cap of teeth and is the hardest substance found in vertebrates. This gene encodes the largest protein in the enamel matrix of developing teeth. The protein is involved in the mineralization and structural organization of enamel. Defects in this gene result in amelogenesis imperfect type 1C. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | ERQQQRPSNILHLPCFGSKLAKHHSSTTGTPSSDGRQSPFDGDSITPTENPNTLVELATEEQFKSINVDPLDADEHSPFEFLQRGTNVQDQVQDCLLLQ |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | ENAM enamelin [ Homo sapiens ] |
Official Symbol | ENAM |
Synonyms | ENAM; enamelin; AIH2, amelogenesis imperfecta 2, hypocalcification (autosomal dominant); amelogenesis imperfecta 2, hypocalcification (autosomal dominant); ADAI; AI1C; AIH2; |
Gene ID | 10117 |
mRNA Refseq | NM_031889 |
Protein Refseq | NP_114095 |
MIM | 606585 |
UniProt ID | Q9NRM1 |
Chromosome Location | 4q13.3 |
Function | structural constituent of tooth enamel; |
◆ Recombinant Proteins | ||
ENAM-8755H | Recombinant Human ENAM protein, His-tagged | +Inquiry |
ENAM-2786M | Recombinant Mouse ENAM Protein, His (Fc)-Avi-tagged | +Inquiry |
ENAM-43H | Recombinant Human ENAM protein, GST-tagged | +Inquiry |
ENAM-5194M | Recombinant Mouse ENAM Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ENAM Products
Required fields are marked with *
My Review for All ENAM Products
Required fields are marked with *