Recombinant Human EPCAM protein

Cat.No. : EPCAM-77H
Product Overview : Recombinant human EPCAM gene (24-265 aa Fragment) fused with 29aa tag domain (which could be removed using TEV enzyme) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 24-265 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVM KAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWI IIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKD VKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
Purity : >90% by SDS-PAGE
Applications : 1. Used as coating matrix protein for Studying ES or iPS cell differentiation in vitro.2. As native antigen for antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name EPCAM epithelial cell adhesion molecule [ Homo sapiens ]
Official Symbol EPCAM
Synonyms EPCAM; epithelial cell adhesion molecule; antigen identified by monoclonal AUA1 , M4S1, MIC18, TACSTD1, tumor associated calcium signal transducer 1; 17 1A; 323/A3; CD326; CO 17A; EGP 2; EGP34; EGP40; Ep CAM; ESA; GA733 2; HEA125; KS1/4; KSA; Ly74; MH9
Gene ID 4072
mRNA Refseq NM_002354
Protein Refseq NP_002345
MIM 185535
UniProt ID P16422
Chromosome Location 2p21
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EPCAM Products

Required fields are marked with *

My Review for All EPCAM Products

Required fields are marked with *

0
cart-icon