Recombinant Human EPCAM protein
Cat.No. : | EPCAM-77H |
Product Overview : | Recombinant human EPCAM gene (24-265 aa Fragment) fused with 29aa tag domain (which could be removed using TEV enzyme) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 24-265 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVM KAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWI IIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKD VKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK |
Purity : | >90% by SDS-PAGE |
Applications : | 1. Used as coating matrix protein for Studying ES or iPS cell differentiation in vitro.2. As native antigen for antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | EPCAM epithelial cell adhesion molecule [ Homo sapiens ] |
Official Symbol | EPCAM |
Synonyms | EPCAM; epithelial cell adhesion molecule; antigen identified by monoclonal AUA1 , M4S1, MIC18, TACSTD1, tumor associated calcium signal transducer 1; 17 1A; 323/A3; CD326; CO 17A; EGP 2; EGP34; EGP40; Ep CAM; ESA; GA733 2; HEA125; KS1/4; KSA; Ly74; MH9 |
Gene ID | 4072 |
mRNA Refseq | NM_002354 |
Protein Refseq | NP_002345 |
MIM | 185535 |
UniProt ID | P16422 |
Chromosome Location | 2p21 |
Function | protein binding; |
◆ Recombinant Proteins | ||
EpCAM-224M | Recombinant Mouse EpCAM Protein, His-tagged | +Inquiry |
EPCAM-186CAF555 | Recombinant Monkey EPCAM Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
EPCAM-77H | Recombinant Human EPCAM protein | +Inquiry |
RFL3774RF | Recombinant Full Length Rat Epithelial Cell Adhesion Molecule(Epcam) Protein, His-Tagged | +Inquiry |
EPCAM-2666H | Recombinant Human EPCAM protein(161-250 aa), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPCAM-1434RCL | Recombinant Rat EPCAM cell lysate | +Inquiry |
EPCAM-2525HCL | Recombinant Human EPCAM cell lysate | +Inquiry |
EPCAM-001CCL | Recombinant Cynomolgus EPCAM cell lysate | +Inquiry |
EPCAM-2143MCL | Recombinant Mouse EPCAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPCAM Products
Required fields are marked with *
My Review for All EPCAM Products
Required fields are marked with *