Recombinant Human EPCAM protein
| Cat.No. : | EPCAM-77H |
| Product Overview : | Recombinant human EPCAM gene (24-265 aa Fragment) fused with 29aa tag domain (which could be removed using TEV enzyme) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 24-265 a.a. |
| Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVM KAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWI IIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKD VKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. Used as coating matrix protein for Studying ES or iPS cell differentiation in vitro.2. As native antigen for antibody production. |
| Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
| Gene Name | EPCAM epithelial cell adhesion molecule [ Homo sapiens ] |
| Official Symbol | EPCAM |
| Synonyms | EPCAM; epithelial cell adhesion molecule; antigen identified by monoclonal AUA1 , M4S1, MIC18, TACSTD1, tumor associated calcium signal transducer 1; 17 1A; 323/A3; CD326; CO 17A; EGP 2; EGP34; EGP40; Ep CAM; ESA; GA733 2; HEA125; KS1/4; KSA; Ly74; MH9 |
| Gene ID | 4072 |
| mRNA Refseq | NM_002354 |
| Protein Refseq | NP_002345 |
| MIM | 185535 |
| UniProt ID | P16422 |
| Chromosome Location | 2p21 |
| Function | protein binding; |
| ◆ Recombinant Proteins | ||
| EPCAM-202CF | Recombinant Monkey EPCAM Protein, His-tagged, FITC conjugated | +Inquiry |
| Epcam-191M | Active Recombinant Mouse Epcam protein, Fc-tagged | +Inquiry |
| EPCAM-81HP | Recombinant Human EPCAM protein, Fc-tagged, R-PE labeled | +Inquiry |
| Epcam-7482RAF488 | Recombinant Rat Epcam Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| EPCAM-62H | Recombinant Human EPCAM Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EPCAM-2525HCL | Recombinant Human EPCAM cell lysate | +Inquiry |
| EPCAM-2143MCL | Recombinant Mouse EPCAM cell lysate | +Inquiry |
| EPCAM-1434RCL | Recombinant Rat EPCAM cell lysate | +Inquiry |
| EPCAM-001CCL | Recombinant Cynomolgus EPCAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPCAM Products
Required fields are marked with *
My Review for All EPCAM Products
Required fields are marked with *
