Recombinant Human EPHB2 Protein, GST-tagged
Cat.No. : | EPHB2-3400H |
Product Overview : | Human EPHB2 partial ORF ( NP_059145, 226 a.a. - 325 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the Eph receptor family of receptor tyrosine kinase transmembrane glycoproteins. These receptors are composed of an N-terminal glycosylated ligand-binding domain, a transmembrane region and an intracellular kinase domain. They bind ligands called ephrins and are involved in diverse cellular processes including motility, division, and differentiation. A distinguishing characteristic of Eph-ephrin signaling is that both receptors and ligands are competent to transduce a signaling cascade, resulting in bidirectional signaling. This protein belongs to a subgroup of the Eph receptors called EphB. Proteins of this subgroup are distinguished from other members of the family by sequence homology and preferential binding affinity for membrane-bound ephrin-B ligands. Allelic variants are associated with prostate and brain cancer susceptibility. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2015] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | CIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EPHB2 EPH receptor B2 [ Homo sapiens ] |
Official Symbol | EPHB2 |
Synonyms | EPHB2; EPH receptor B2; DRT, EphB2 , EPHT3, ERK; ephrin type-B receptor 2; Hek5; Tyro5; EPH-like kinase 5; eph tyrosine kinase 3; elk-related tyrosine kinase; protein-tyrosine kinase HEK5; tyrosine-protein kinase TYRO5; renal carcinoma antigen NY-REN-47; tyrosine-protein kinase receptor EPH-3; developmentally-regulated Eph-related tyrosine kinase; DRT; EK5; ERK; CAPB; PCBC; EPHT3; MGC87492; |
Gene ID | 2048 |
mRNA Refseq | NM_004442 |
Protein Refseq | NP_004433 |
MIM | 600997 |
UniProt ID | P29323 |
◆ Recombinant Proteins | ||
EPHB2-18H | Recombinant Human EPH receptor B2 Protein, His tagged | +Inquiry |
EPHB2-3400H | Recombinant Human EPHB2 Protein, GST-tagged | +Inquiry |
EPHB2-469H | Recombinant Human EPHB2, ENLYFQ tagged | +Inquiry |
Ephb2-496M | Active Recombinant Mouse Ephb2 protein(Met1-Lys540), hFc-tagged | +Inquiry |
EPHB2-375H | Recombinant Human EPHB2 Protein, DDK/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPHB2-001HCL | Recombinant Human EPHB2 cell lysate | +Inquiry |
EPHB2-001MCL | Recombinant Mouse EPHB2 cell lysate | +Inquiry |
EPHB2-1106HCL | Recombinant Human EPHB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPHB2 Products
Required fields are marked with *
My Review for All EPHB2 Products
Required fields are marked with *