Recombinant Human EPHB2 Protein, GST-tagged

Cat.No. : EPHB2-3400H
Product Overview : Human EPHB2 partial ORF ( NP_059145, 226 a.a. - 325 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the Eph receptor family of receptor tyrosine kinase transmembrane glycoproteins. These receptors are composed of an N-terminal glycosylated ligand-binding domain, a transmembrane region and an intracellular kinase domain. They bind ligands called ephrins and are involved in diverse cellular processes including motility, division, and differentiation. A distinguishing characteristic of Eph-ephrin signaling is that both receptors and ligands are competent to transduce a signaling cascade, resulting in bidirectional signaling. This protein belongs to a subgroup of the Eph receptors called EphB. Proteins of this subgroup are distinguished from other members of the family by sequence homology and preferential binding affinity for membrane-bound ephrin-B ligands. Allelic variants are associated with prostate and brain cancer susceptibility. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2015]
Molecular Mass : 36.63 kDa
AA Sequence : CIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EPHB2 EPH receptor B2 [ Homo sapiens ]
Official Symbol EPHB2
Synonyms EPHB2; EPH receptor B2; DRT, EphB2 , EPHT3, ERK; ephrin type-B receptor 2; Hek5; Tyro5; EPH-like kinase 5; eph tyrosine kinase 3; elk-related tyrosine kinase; protein-tyrosine kinase HEK5; tyrosine-protein kinase TYRO5; renal carcinoma antigen NY-REN-47; tyrosine-protein kinase receptor EPH-3; developmentally-regulated Eph-related tyrosine kinase; DRT; EK5; ERK; CAPB; PCBC; EPHT3; MGC87492;
Gene ID 2048
mRNA Refseq NM_004442
Protein Refseq NP_004433
MIM 600997
UniProt ID P29323

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EPHB2 Products

Required fields are marked with *

My Review for All EPHB2 Products

Required fields are marked with *

0
cart-icon