Recombinant Human FGF21 Full Length protein, His-tagged
| Cat.No. : | FGF21-564H |
| Product Overview : | Recombinant Human FGF21 protein(His29-Ser209), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | November 17, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | His29-Ser209 |
| Tag : | N-His |
| Form : | Liquid in sterile PBS, pH7.4, 5% Trehalose. |
| Molecular Mass : | The protein has a calculated MW of 20 kDa. |
| Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
| Purity : | > 90 % as determined by SDS-PAGE. |
| Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1.0 mg/ml. |
| Reconstitution : | Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | MHHHHHHHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS |
| Gene Name | FGF21 fibroblast growth factor 21 [ Homo sapiens ] |
| Official Symbol | FGF21 |
| Synonyms | FGF21; fibroblast growth factor 21; FGF-21; |
| Gene ID | 26291 |
| mRNA Refseq | NM_019113 |
| Protein Refseq | NP_061986 |
| MIM | 609436 |
| UniProt ID | Q9NSA1 |
| ◆ Recombinant Proteins | ||
| FGF21-4111H | Recombinant Human FGF21 Protein, GST-tagged | +Inquiry |
| Fgf21-194R | Recombinant Rat Pdgfa protein, His/S-tagged | +Inquiry |
| FGF21-626B | Recombinant Bovine Fibroblast Growth Factor 21 | +Inquiry |
| Fgf21-110M | Recombinant Mouse Fibroblast Growth Factor 21, His-tagged | +Inquiry |
| Fgf21-1491R | Recombinant Rat Fgf21 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FGF21-1890MCL | Recombinant Mouse FGF21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF21 Products
Required fields are marked with *
My Review for All FGF21 Products
Required fields are marked with *
