Recombinant Human FGF21 Full Length protein, His-tagged

Cat.No. : FGF21-564H
Product Overview : Recombinant Human FGF21 protein(His29-Ser209), fused with N-terminal His tag, was expressed in E. coli.
Availability July 26, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : His29-Ser209
Tag : N-His
Form : Liquid in sterile PBS, pH7.4, 5% Trehalose.
Molecular Mass : The protein has a calculated MW of 20 kDa.
Endotoxin : <1.0EU per 1μg (determined by the LAL method).
Purity : > 90 % as determined by SDS-PAGE.
Storage : Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1.0 mg/ml.
Reconstitution : Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : MHHHHHHHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Gene Name FGF21 fibroblast growth factor 21 [ Homo sapiens ]
Official Symbol FGF21
Synonyms FGF21; fibroblast growth factor 21; FGF-21;
Gene ID 26291
mRNA Refseq NM_019113
Protein Refseq NP_061986
MIM 609436
UniProt ID Q9NSA1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF21 Products

Required fields are marked with *

My Review for All FGF21 Products

Required fields are marked with *

0
cart-icon