Recombinant Human FGF21 protein, His-tagged
| Cat.No. : | FGF21-5381H |
| Product Overview : | Recombinant Human FGF21 protein(60-209 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 60-209 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 75%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | HLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS |
| Gene Name | FGF21 fibroblast growth factor 21 [ Homo sapiens ] |
| Official Symbol | FGF21 |
| Synonyms | FGF21; fibroblast growth factor 21; FGF-21; |
| Gene ID | 26291 |
| mRNA Refseq | NM_019113 |
| Protein Refseq | NP_061986 |
| MIM | 609436 |
| UniProt ID | Q9NSA1 |
| ◆ Recombinant Proteins | ||
| Fgf21-1491R | Recombinant Rat Fgf21 Protein, His-tagged | +Inquiry |
| FGF21-117H | Active Recombinant Human FGF21 Protein (His29-Ser209), C-His tagged, Animal-free, Carrier-free | +Inquiry |
| FGF21-287F | Active Recombinant Human FGF21 Protein, His-tagged | +Inquiry |
| Fgf21-504M | Recombinant Mouse Fgf21 | +Inquiry |
| FGF21-4310Z | Recombinant Zebrafish FGF21 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FGF21-1890MCL | Recombinant Mouse FGF21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF21 Products
Required fields are marked with *
My Review for All FGF21 Products
Required fields are marked with *
