Recombinant Human FGF21 protein, His-tagged
Cat.No. : | FGF21-5381H |
Product Overview : | Recombinant Human FGF21 protein(60-209 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 60-209 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 75%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | HLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS |
Gene Name | FGF21 fibroblast growth factor 21 [ Homo sapiens ] |
Official Symbol | FGF21 |
Synonyms | FGF21; fibroblast growth factor 21; FGF-21; |
Gene ID | 26291 |
mRNA Refseq | NM_019113 |
Protein Refseq | NP_061986 |
MIM | 609436 |
UniProt ID | Q9NSA1 |
◆ Recombinant Proteins | ||
FGF21-36M | Recombinant Mouse FGF21 Protein, His-tagged | +Inquiry |
Fgf21-574M | Recombinant Mouse Fgf21 protein, His-tagged | +Inquiry |
FGF21-3279H | Recombinant Human FGF21 protein, His-tagged | +Inquiry |
FGF21-133H | Recombinant Human FGF21 Protein, His-tagged | +Inquiry |
FGF21-103H | Recombinant Human Fibroblast Growth Factor 21 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF21-1890MCL | Recombinant Mouse FGF21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF21 Products
Required fields are marked with *
My Review for All FGF21 Products
Required fields are marked with *