Recombinant Human FGF7 therapeutic protein(Palifermin)
Cat.No. : | FGF7-P013H |
Product Overview : | Recombinant Human Fibroblast Growth Factor 7 therapeutic protein is a recombinant human keratinocyte growth factor (KGF). It is 140 residues long, and is produced using E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 139aa |
Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. Studies of mouse and rat homologs of this gene implicated roles in morphogenesis of epithelium, reepithelialization of wounds, hair development and early lung organogenesis.The expression product is the active ingredient of Kepivance. |
Molecular Mass : | 16.2kDa |
AA Sequence : | SYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEG KLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT |
Purity : | >95% |
Alias : | FGF7; KGF; FGF-7; HBGF-7; Palifermin |
Gene Name | FGF7 fibroblast growth factor 7 [ Homo sapiens ] |
Official Symbol | FGF7 |
Synonyms | FGF7; fibroblast growth factor 7; fibroblast growth factor 7 (keratinocyte growth factor); keratinocyte growth factor; KGF; FGF-7; heparin-binding growth factor 7; HBGF-7; |
Gene ID | 2252 |
mRNA Refseq | NM_002009 |
Protein Refseq | NP_002000 |
MIM | 148180 |
UniProt ID | P21781 |
Chromosome Location | 15q21.2 |
Pathway | Downstream signaling of activated FGFR, organism-specific biosystem; FGFR ligand binding and activation, organism-specific biosystem; FGFR2 ligand binding and activation, organism-specific biosystem; FGFR2b ligand binding and activation, organism-specific biosystem; FRS2-mediated cascade, organism-specific biosystem; Glypican 3 network, organism-specific biosystem; IRS-mediated signalling, organism-specific biosystem; |
Function | chemoattractant activity; growth factor activity; heparin binding; type 2 fibroblast growth factor receptor binding; |
◆ Recombinant Proteins | ||
FGF7-638H | Active Recombinant Human FGF7 Protein | +Inquiry |
FGF7-90H | Active Recombinant Human FGF7 Protein | +Inquiry |
FGF7-3020H | Recombinant Human FGF7 Protein (Thr23-Thr216), C-His tagged | +Inquiry |
FGF7-2913H | Recombinant Human FGF7 protein, His-B2M-tagged | +Inquiry |
FGF7-1900C | Recombinant Chicken FGF7 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF7-6236HCL | Recombinant Human FGF7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF7 Products
Required fields are marked with *
My Review for All FGF7 Products
Required fields are marked with *