Recombinant Human FKBP1A protein, GST-tagged
Cat.No. : | FKBP1A-2920H |
Product Overview : | Recombinant Human FKBP1A protein(P62942)(2-103aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 2-103aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 38.2 kDa |
AA Sequence : | GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | FKBP1A FK506 binding protein 1A, 12kDa [ Homo sapiens ] |
Official Symbol | FKBP1A |
Synonyms | FKBP1A; FK506 binding protein 1A, 12kDa; FK506 binding protein 1A (12kD) , FKBP1; peptidyl-prolyl cis-trans isomerase FKBP1A; FKBP 12; FKBP12; FKBP12C; PKC12; PPIASE; rotamase; 12 kDa FKBP; calstabin-1; FKBP12-Exip3; PPIase FKBP1A; immunophilin FKBP12; FK506 binding protein12; FK506-binding protein 1; FK506-binding protein 12; 12 kDa FK506-binding protein; protein kinase C inhibitor 2; FK506-binding protein 1A (12kD); FK506-binding protein, T-cell, 12-kD; FKBP1; PKCI2; FKBP-12; FKBP-1A; |
Gene ID | 2280 |
mRNA Refseq | NM_000801 |
Protein Refseq | NP_000792 |
MIM | 186945 |
UniProt ID | P62942 |
◆ Recombinant Proteins | ||
FKBP1A-916H | Recombinant Human FKBP1A Protein, His (Fc)-Avi-tagged | +Inquiry |
FKBP1A-2009R | Recombinant Rat FKBP1A Protein, His (Fc)-Avi-tagged | +Inquiry |
FKBP1A-621H | Active Recombinant Human FKBP1A, Met&His-tagged | +Inquiry |
FKBP1A-2353R | Recombinant Rat FKBP1A Protein | +Inquiry |
FKBP1A-057H | Recombinant Human FKBP1A Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP1A-6211HCL | Recombinant Human FKBP1A 293 Cell Lysate | +Inquiry |
FKBP1A-6210HCL | Recombinant Human FKBP1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FKBP1A Products
Required fields are marked with *
My Review for All FKBP1A Products
Required fields are marked with *