Recombinant Human FKBP1A protein, GST-tagged

• Cat.No.: FKBP1A-2920H
• Product Overview: Recombinant Human FKBP1A protein(P62942)(2-103aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 2-103aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 38.2 kDa
• AA Sequence: GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: FKBP1A FK506 binding protein 1A, 12kDa [ Homo sapiens ]
• Official Symbol: FKBP1A
• Synonyms: FKBP1A; FK506 binding protein 1A, 12kDa; FK506 binding protein 1A (12kD) , FKBP1; peptidyl-prolyl cis-trans isomerase FKBP1A; FKBP 12; FKBP12; FKBP12C; PKC12; PPIASE; rotamase; 12 kDa FKBP; calstabin-1; FKBP12-Exip3; PPIase FKBP1A; immunophilin FKBP12; FK506 binding protein12; FK506-binding protein 1; FK506-binding protein 12; 12 kDa FK506-binding protein; protein kinase C inhibitor 2; FK506-binding protein 1A (12kD); FK506-binding protein, T-cell, 12-kD; FKBP1; PKCI2; FKBP-12; FKBP-1A
• Gene ID: 2280
• mRNA Refseq: NM_000801
• Protein Refseq: NP_000792
• MIM: 186945
• UniProt ID: P62942