Recombinant Human FKBP1A protein, GST-tagged

Cat.No. : FKBP1A-2920H
Product Overview : Recombinant Human FKBP1A protein(P62942)(2-103aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 2-103aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 38.2 kDa
AA Sequence : GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVE
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name FKBP1A FK506 binding protein 1A, 12kDa [ Homo sapiens ]
Official Symbol FKBP1A
Synonyms FKBP1A; FK506 binding protein 1A, 12kDa; FK506 binding protein 1A (12kD) , FKBP1; peptidyl-prolyl cis-trans isomerase FKBP1A; FKBP 12; FKBP12; FKBP12C; PKC12; PPIASE; rotamase; 12 kDa FKBP; calstabin-1; FKBP12-Exip3; PPIase FKBP1A; immunophilin FKBP12; FK506 binding protein12; FK506-binding protein 1; FK506-binding protein 12; 12 kDa FK506-binding protein; protein kinase C inhibitor 2; FK506-binding protein 1A (12kD); FK506-binding protein, T-cell, 12-kD; FKBP1; PKCI2; FKBP-12; FKBP-1A;
Gene ID 2280
mRNA Refseq NM_000801
Protein Refseq NP_000792
MIM 186945
UniProt ID P62942

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FKBP1A Products

Required fields are marked with *

My Review for All FKBP1A Products

Required fields are marked with *

0
cart-icon