Recombinant Human FKBP1A protein, GST-tagged
| Cat.No. : | FKBP1A-2920H |
| Product Overview : | Recombinant Human FKBP1A protein(P62942)(2-103aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 2-103aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 38.2 kDa |
| AA Sequence : | GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | FKBP1A FK506 binding protein 1A, 12kDa [ Homo sapiens ] |
| Official Symbol | FKBP1A |
| Synonyms | FKBP1A; FK506 binding protein 1A, 12kDa; FK506 binding protein 1A (12kD) , FKBP1; peptidyl-prolyl cis-trans isomerase FKBP1A; FKBP 12; FKBP12; FKBP12C; PKC12; PPIASE; rotamase; 12 kDa FKBP; calstabin-1; FKBP12-Exip3; PPIase FKBP1A; immunophilin FKBP12; FK506 binding protein12; FK506-binding protein 1; FK506-binding protein 12; 12 kDa FK506-binding protein; protein kinase C inhibitor 2; FK506-binding protein 1A (12kD); FK506-binding protein, T-cell, 12-kD; FKBP1; PKCI2; FKBP-12; FKBP-1A; |
| Gene ID | 2280 |
| mRNA Refseq | NM_000801 |
| Protein Refseq | NP_000792 |
| MIM | 186945 |
| UniProt ID | P62942 |
| ◆ Recombinant Proteins | ||
| FKBP1A-2529H | Recombinant Human FKBP1A Protein (Gly2-Glu108), N-His tagged | +Inquiry |
| FKBP1A-1987H | Recombinant Human FKBP1A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| FKBP1A-1372HFL | Recombinant Full Length Human FKBP1A Protein, C-Flag-tagged | +Inquiry |
| Fkbp1a-7208M | Recombinant Mouse Fkbp1a Protein, His-tagged | +Inquiry |
| FKBP1A-621H | Active Recombinant Human FKBP1A, Met&His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FKBP1A-6210HCL | Recombinant Human FKBP1A 293 Cell Lysate | +Inquiry |
| FKBP1A-6211HCL | Recombinant Human FKBP1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FKBP1A Products
Required fields are marked with *
My Review for All FKBP1A Products
Required fields are marked with *




