Recombinant Human FLT3 Protein, GMP Grade, Animal-Free
| Cat.No. : | FLT3-29HG |
| Product Overview : | GMP Recombinant Human FLT3 protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Description : | Flt3-Ligand is a growth factor that regulates proliferation of early hematopoietic cells. Flt3-Ligand binds to cells expressing the tyrosine kinase receptor Flt3. Flt3-Ligand, by itself does not stimulate proliferation of early hematopoietic cells, but synergizes with other CSFs and interleukins to induce growth and differentiation. Unlike SCF, Flt3-Ligand exerts no activity on mast cells. Multiple isoforms of Flt3-Ligand have been identified. The predominant biologically active form is anchored to the cell surface as the extracellular domain of a transmembrane protein (209 a.a.). The membrane-bound isoform can be proteolytically cleaved to generate a biologically active soluble isoform. |
| AA Sequence : | MTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA |
| Purity : | ≥ 98% by SDS-PAGE gel and HPLC analyses. |
| Gene Name | FLT3 fms-related tyrosine kinase 3 [ Homo sapiens (human) ] |
| Official Symbol | FLT3 |
| Synonyms | FLT3; fms-related tyrosine kinase 3; receptor-type tyrosine-protein kinase FLT3; CD135; FLK2; STK1; STK-1; CD135 antigen; FL cytokine receptor; fetal liver kinase 2; fms-like tyrosine kinase 3; stem cell tyrosine kinase 1; growth factor receptor tyrosine kinase type III; FLK-2; |
| Gene ID | 2322 |
| mRNA Refseq | NM_004119 |
| Protein Refseq | NP_004110 |
| MIM | 136351 |
| UniProt ID | P36888 |
| ◆ Recombinant Proteins | ||
| FLT3-2243HAF647 | Recombinant Human FLT3 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| FLT3-28340TH | Recombinant Human FLT3, His-tagged | +Inquiry |
| FLT3-2243H | Active Recombinant Human FLT3, His tagged | +Inquiry |
| FLT3-4902H | Active Recombinant Human FLT3 protein, GST/His-tagged | +Inquiry |
| FLT3-5764H | Recombinant Human FLT3 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FLT3-2561HCL | Recombinant Human FLT3 cell lysate | +Inquiry |
| FLT3-970MCL | Recombinant Mouse FLT3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLT3 Products
Required fields are marked with *
My Review for All FLT3 Products
Required fields are marked with *
