Recombinant Human FPR1 protein, His-tagged
| Cat.No. : | FPR1-2994H |
| Product Overview : | Recombinant Human FPR1 protein(140-203 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 25, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 140-203 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | SLAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLTVRGI |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | FPR1 formyl peptide receptor 1 [ Homo sapiens ] |
| Official Symbol | FPR1 |
| Synonyms | FPR1; formyl peptide receptor 1; fMet-Leu-Phe receptor; FMLP; FPR; fMLP receptor; N-formylpeptide chemoattractant receptor; |
| Gene ID | 2357 |
| mRNA Refseq | NM_001193306 |
| Protein Refseq | NP_001180235 |
| MIM | 136537 |
| UniProt ID | P21462 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FPR1 Products
Required fields are marked with *
My Review for All FPR1 Products
Required fields are marked with *
