Recombinant Human FPR1 protein, His-tagged
Cat.No. : | FPR1-2994H |
Product Overview : | Recombinant Human FPR1 protein(140-203 aa), fused to His tag, was expressed in E. coli. |
Availability | September 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 140-203 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SLAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLTVRGI |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FPR1 formyl peptide receptor 1 [ Homo sapiens ] |
Official Symbol | FPR1 |
Synonyms | FPR1; formyl peptide receptor 1; fMet-Leu-Phe receptor; FMLP; FPR; fMLP receptor; N-formylpeptide chemoattractant receptor; |
Gene ID | 2357 |
mRNA Refseq | NM_001193306 |
Protein Refseq | NP_001180235 |
MIM | 136537 |
UniProt ID | P21462 |
◆ Recombinant Proteins | ||
FPR1-2489H | Recombinant Human FPR1 Protein (306-350 aa), His-GST-Myc-tagged | +Inquiry |
FPR1-682HF | Recombinant Full Length Human FPR1 Protein, GST-tagged | +Inquiry |
FPR1-2994H | Recombinant Human FPR1 protein, His-tagged | +Inquiry |
FPR1-274H | Recombinant Human FPR1 protein, GST-tagged | +Inquiry |
RFL17980PF | Recombinant Full Length Pongo Pygmaeus Fmet-Leu-Phe Receptor(Fpr1) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FPR1 Products
Required fields are marked with *
My Review for All FPR1 Products
Required fields are marked with *