Recombinant Human frizzled class receptor 10 Protein, His&Fc tagged

Cat.No. : FZD10-13H
Product Overview : Recombinant human Frizzled-10 (21-225aa), fused to hIgG-His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc&His
Protein Length : 21-225aa
Description : This gene is a member of the frizzled gene family. Members of this family encode 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.
Tag : C-His&Fc
Form : Liquid
Molecular Mass : 50 kDa
AA Sequence : ISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEHPLKDGGPGRGGCDNPGKFHHVEKSASCAPLCTPGVDVYWSREDKR
Endotoxin : < 1 EU/μg, determined by LAL method.
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name FZD10 frizzled class receptor 10 [ Homo sapiens (human) ]
Official Symbol FZD10
Synonyms FZD10; frizzled class receptor 10; Fz10; FzE7; CD350; FZ-10; hFz10; frizzled-10; frizzled 10, seven transmembrane spanning receptor; frizzled family receptor 10; frizzled homolog 10
Gene ID 11211
mRNA Refseq NM_007197
Protein Refseq NP_009128
MIM 606147
UniProt ID Q9ULW2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FZD10 Products

Required fields are marked with *

My Review for All FZD10 Products

Required fields are marked with *

0
cart-icon