Recombinant Human frizzled class receptor 10 Protein, His&Fc tagged
Cat.No. : | FZD10-13H |
Product Overview : | Recombinant human Frizzled-10 (21-225aa), fused to hIgG-His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc&His |
Protein Length : | 21-225aa |
Description : | This gene is a member of the frizzled gene family. Members of this family encode 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer. |
Tag : | C-His&Fc |
Form : | Liquid |
Molecular Mass : | 50 kDa |
AA Sequence : | ISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEHPLKDGGPGRGGCDNPGKFHHVEKSASCAPLCTPGVDVYWSREDKR |
Endotoxin : | < 1 EU/μg, determined by LAL method. |
Purity : | > 90% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5 mg/mL (determined by Absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | FZD10 frizzled class receptor 10 [ Homo sapiens (human) ] |
Official Symbol | FZD10 |
Synonyms | FZD10; frizzled class receptor 10; Fz10; FzE7; CD350; FZ-10; hFz10; frizzled-10; frizzled 10, seven transmembrane spanning receptor; frizzled family receptor 10; frizzled homolog 10 |
Gene ID | 11211 |
mRNA Refseq | NM_007197 |
Protein Refseq | NP_009128 |
MIM | 606147 |
UniProt ID | Q9ULW2 |
◆ Recombinant Proteins | ||
FZD10-5069HF | Recombinant Full Length Human FZD10 Protein | +Inquiry |
FZD10-283H | Recombinant Human FZD10, Fc-tagged | +Inquiry |
Fzd10-4043M | Recombinant Mouse Fzd10 protein(Met1-Gly162), His-tagged | +Inquiry |
RFL2290GF | Recombinant Full Length Chicken Frizzled-10(Fzd10) Protein, His-Tagged | +Inquiry |
FZD10-13064H | Recombinant Human FZD10, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FZD10-2118MCL | Recombinant Mouse FZD10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FZD10 Products
Required fields are marked with *
My Review for All FZD10 Products
Required fields are marked with *
0
Inquiry Basket