Recombinant Human FZD10 Protein, GST-tagged

Cat.No. : FZD10-4590H
Product Overview : Human FZD10 partial ORF ( NP_009128.1, 96 a.a. - 183 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the frizzled gene family. Members of this family encode 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer. [provided by RefSeq
Molecular Mass : 35.42 kDa
AA Sequence : TEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEHPLK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FZD10 frizzled family receptor 10 [ Homo sapiens ]
Official Symbol FZD10
Synonyms FZD10; frizzled family receptor 10; frizzled (Drosophila) homolog 10, frizzled 10, seven transmembrane spanning receptor, frizzled homolog 10 (Drosophila); frizzled-10; CD350; frizzled homolog 10; frizzled 10, seven transmembrane spanning receptor; Fz10; FzE7; FZ-10; hFz10;
Gene ID 11211
mRNA Refseq NM_007197
Protein Refseq NP_009128
MIM 606147
UniProt ID Q9ULW2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FZD10 Products

Required fields are marked with *

My Review for All FZD10 Products

Required fields are marked with *

0
cart-icon
0
compare icon