Recombinant Human FZD10 Protein, GST-tagged
Cat.No. : | FZD10-4590H |
Product Overview : | Human FZD10 partial ORF ( NP_009128.1, 96 a.a. - 183 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the frizzled gene family. Members of this family encode 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer. [provided by RefSeq |
Molecular Mass : | 35.42 kDa |
AA Sequence : | TEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEHPLK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FZD10 frizzled family receptor 10 [ Homo sapiens ] |
Official Symbol | FZD10 |
Synonyms | FZD10; frizzled family receptor 10; frizzled (Drosophila) homolog 10, frizzled 10, seven transmembrane spanning receptor, frizzled homolog 10 (Drosophila); frizzled-10; CD350; frizzled homolog 10; frizzled 10, seven transmembrane spanning receptor; Fz10; FzE7; FZ-10; hFz10; |
Gene ID | 11211 |
mRNA Refseq | NM_007197 |
Protein Refseq | NP_009128 |
MIM | 606147 |
UniProt ID | Q9ULW2 |
◆ Recombinant Proteins | ||
FZD10-5069HF | Recombinant Full Length Human FZD10 Protein | +Inquiry |
FZD10-1471H | Recombinant Human FZD10 protein, His-tagged | +Inquiry |
Fzd10-4043M | Recombinant Mouse Fzd10 protein(Met1-Gly162), His-tagged | +Inquiry |
FZD10-2184H | Recombinant Human FZD10 protein, His-tagged | +Inquiry |
Fzd10-276M | Active Recombinant Mouse Fzd10 protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FZD10-2118MCL | Recombinant Mouse FZD10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FZD10 Products
Required fields are marked with *
My Review for All FZD10 Products
Required fields are marked with *