Recombinant Human Full length PRDX2 protein(1-198 aa), C-His-tagged

• Cat.No.: PRDX2-2875H
• Product Overview: Recombinant Human Full length PRDX2 protein(P32119)(1-198 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-198 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

Gene Information

• Gene Name: PRDX2 peroxiredoxin 2 [ Homo sapiens ]
• Official Symbol: PRDX2
• Synonyms: PRDX2; peroxiredoxin 2; TDPX1; peroxiredoxin-2; MGC4104; natural killer enhancing factor B; NKEFB; PRP; PRX2; PRXII; thiol specific antioxidant 1; thioredoxin peroxidase 1; thioredoxin dependent peroxide reductase 1; torin; TSA; NKEF-B; thiol-specific antioxidant 1; thiol-specific antioxidant protein; natural killer cell-enhancing factor B; thioredoxin-dependent peroxide reductase 1; TPX1
• Gene ID: 7001
• mRNA Refseq: NM_005809
• Protein Refseq: NP_005800
• MIM: 600538
• UniProt ID: P32119