Recombinant Human Full length PRDX2 protein(1-198 aa), C-His-tagged

Cat.No. : PRDX2-2875H
Product Overview : Recombinant Human Full length PRDX2 protein(P32119)(1-198 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-198 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
Gene Name PRDX2 peroxiredoxin 2 [ Homo sapiens ]
Official Symbol PRDX2
Synonyms PRDX2; peroxiredoxin 2; TDPX1; peroxiredoxin-2; MGC4104; natural killer enhancing factor B; NKEFB; PRP; PRX2; PRXII; thiol specific antioxidant 1; thioredoxin peroxidase 1; thioredoxin dependent peroxide reductase 1; torin; TSA; NKEF-B; thiol-specific antioxidant 1; thiol-specific antioxidant protein; natural killer cell-enhancing factor B; thioredoxin-dependent peroxide reductase 1; TPX1;
Gene ID 7001
mRNA Refseq NM_005809
Protein Refseq NP_005800
MIM 600538
UniProt ID P32119

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRDX2 Products

Required fields are marked with *

My Review for All PRDX2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon