Recombinant Human GDF6 protein
Cat.No. : | GDF6-381H |
Product Overview : | Recombinant Human GDF6 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 120 |
Description : | Growth/differentiation factors (GDF-1 to GDF-15) are members of the BMP family of TGF-beta superfamily proteins. They are produced as inactive preproproteins which are then cleaved and assembled into active secreted homodimers. GDF dimers are disulfide-linked with the exception of GDF-3 and -9. GDF proteins are important during embryonic development, particularly in the skeletal, nervous, and muscular systems. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is less than 2.0 μg/ml, corresponding to a specific activity of > 500 IU/mg. |
Molecular Mass : | Approximately 27.1 kDa, a disulfide-linked homodimeric protein containing two 120 amino acids. |
AA Sequence : | TAFASRHGKRHGKKSRLRCSKKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR |
Endotoxin : | Less than 0.1 EU/µg of rHuGDF-6/BMP-13 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | GDF6 |
Official Symbol | GDF6 |
Synonyms | GDF6; growth differentiation factor 6; growth/differentiation factor 6; BMP13; GDF-6; Klippel-Feil syndrome; Klip-Feil malformation; Klippel-Feil malformation; growth/differentiation factor 16; KFM; KFS; KFS1; KFSL; SGM1; CDMP2; MCOP4; SCDO4; MCOPCB6; MGC158100; MGC158101; |
Gene ID | 392255 |
mRNA Refseq | NM_001001557 |
Protein Refseq | NP_001001557 |
MIM | 601147 |
UniProt ID | Q6KF10 |
◆ Recombinant Proteins | ||
GDF6-2159R | Recombinant Rat GDF6 Protein, His (Fc)-Avi-tagged | +Inquiry |
Gdf6-278M | Recombinant Mouse Gdf6 Protein, His-tagged | +Inquiry |
GDF6-3027H | Recombinant Human GDF6 Protein, His (Fc)-Avi-tagged | +Inquiry |
GDF6-277H | Recombinant Human GDF6 Protein, His-tagged | +Inquiry |
GDF6-381H | Recombinant Human GDF6 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDF6-5967HCL | Recombinant Human GDF6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GDF6 Products
Required fields are marked with *
My Review for All GDF6 Products
Required fields are marked with *
0
Inquiry Basket