| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
134 |
| Description : |
Glial cell-derived neurotrophic factor is a neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake. It is a founding member of the GDNF family of ligands (GFL) and has been shown to interact with GFRA2 and GDNF family receptor alpha. GDNF (monomer) contains seven conserved cysteine residues, one of which (Cys 101) is used for inter-chain disulfide bridging and the others are involved in intramolecular ring formation known as the cysteine knot configuration. Rat and human mature GDNF shows 93 % sequence identity and have species cross-reactivity. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in 1 × PBS, pH 7.4, with 0.05 % Tween-20. |
| Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using rat C6 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 5.0 × 10⁷ IU/mg. |
| Molecular Mass : |
Approximately 30.1 kDa, a homodimeric protein consisting of two 134 amino acid non-glycosylated polypeptide chains. |
| AA Sequence : |
SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI |
| Endotoxin : |
Less than 0.1 EU/μg of rHuGDNF as determined by LAL method. |
| Purity : |
>97% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |