Recombinant Human GP1BB Full Length Transmembrane protein (26-206 aa), His-SUMO-Myc-tagged
| Cat.No. : | GP1BB-2723H |
| Product Overview : | Recombinant Human GP1BB Protein (26-206 aa) is produced by in vitro E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc&SUMO |
| Protein Length : | 26-206aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 39.3 kDa |
| AA Sequence : | CPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRARARARAAARLSLTDPLVAERAGTDES |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | GP1BB glycoprotein Ib (platelet), beta polypeptide [ Homo sapiens ] |
| Official Symbol | GP1BB |
| Synonyms | GP1BB; glycoprotein Ib (platelet), beta polypeptide; platelet glycoprotein Ib beta chain; CD42c; GPIb-beta; GP-Ib beta; antigen CD42b-beta; nuclear localization signal deleted in velocardiofacial syndrome; BS; CD42C; GPIBB; BDPLT1; |
| Gene ID | 2812 |
| mRNA Refseq | NM_000407 |
| Protein Refseq | NP_000398 |
| MIM | 138720 |
| UniProt ID | P13224 |
| ◆ Recombinant Proteins | ||
| GP1BB-5463HF | Recombinant Full Length Human GP1BB Protein | +Inquiry |
| GP1BB-4206H | Recombinant Human GP1BB Protein (Met1-Cys147), C-His tagged | +Inquiry |
| GP1BB-2247H | Recombinant Human GP1BB protein, His-tagged | +Inquiry |
| RFL15947MF | Recombinant Full Length Mouse Platelet Glycoprotein Ib Beta Chain(Gp1Bb) Protein, His-Tagged | +Inquiry |
| GP1BB-15H | Active Recombinant Human GP1BB Protein (26-147aa), C-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GP1BB-2588HCL | Recombinant Human GP1BB cell lysate | +Inquiry |
| GP1BB-1243RCL | Recombinant Rat GP1BB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GP1BB Products
Required fields are marked with *
My Review for All GP1BB Products
Required fields are marked with *
