Recombinant Human GP1BB Full Length Transmembrane protein (26-206 aa), His-SUMO-Myc-tagged
Cat.No. : | GP1BB-2723H |
Product Overview : | Recombinant Human GP1BB Protein (26-206 aa) is produced by in vitro E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 26-206aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.3 kDa |
AA Sequence : | CPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRARARARAAARLSLTDPLVAERAGTDES |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GP1BB glycoprotein Ib (platelet), beta polypeptide [ Homo sapiens ] |
Official Symbol | GP1BB |
Synonyms | GP1BB; glycoprotein Ib (platelet), beta polypeptide; platelet glycoprotein Ib beta chain; CD42c; GPIb-beta; GP-Ib beta; antigen CD42b-beta; nuclear localization signal deleted in velocardiofacial syndrome; BS; CD42C; GPIBB; BDPLT1; |
Gene ID | 2812 |
mRNA Refseq | NM_000407 |
Protein Refseq | NP_000398 |
MIM | 138720 |
UniProt ID | P13224 |
◆ Cell & Tissue Lysates | ||
GP1BB-2588HCL | Recombinant Human GP1BB cell lysate | +Inquiry |
GP1BB-1243RCL | Recombinant Rat GP1BB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GP1BB Products
Required fields are marked with *
My Review for All GP1BB Products
Required fields are marked with *